KEGG   Rattus norvegicus (rat): 314265Help
Entry
314265            CDS       T01003                                 

Gene name
Zfyve26
Definition
(RefSeq) zinc finger FYVE-type containing 26
  KO
K19027  zinc finger FYVE domain-containing protein 26
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    314265 (Zfyve26)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     314265 (Zfyve26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE MerR-DNA-bind TPR_2
Motif
Other DBs
NCBI-GeneID: 314265
NCBI-ProteinID: NP_001101508
RGD: 1307820
Ensembl: ENSRNOG00000059875
UniProt: D4A8G9
Position
6q24
AA seq 2542 aa AA seqDB search
MSYPFGKEETTTEKQLFEFFCECLRRGDWELAQACVPQLQRGQGEIPQKVEDILQALVQC
PILLRCGPDINPQRLAWLWLLVLEKWLPPEKKLLSTVFRRKLEFLFLSEDLQGGIPETIL
KELFETLAQGPAGCTSDRSQRWESGAPQLSPEAVSMLWNLLKQAPGPAQALLELLLEERH
SASLCHSSLQKSLLDLIRKALQTLRDPASQPAGVTDAVCGALQALCCTAELPEGEWHVLC
EELLETCRTEGSPLKEERLLGCLLHKAGRSLLSLYGHTYAEKVAERPPKASLSGKDHPDP
ERAMLALFSTPDPAHAWKMAFFYCLSNNKHFLEQILVTALTLLKEEDFPSLGYLLDREFR
PLSHLLVLLGWTHCQSLESAKRLLQTLYRNQDQGHDELLRDACEGLWAHLEVLEWCVQQS
SSLIPKRELLCHLHGGDSHSVLYSLHHLTNLPALREEEVLKLLQKVPTKDLQGEHDTHDA
SVPEHLSQCQSLTLYQGFCAMKYAVYALCVNSHQHSQCPDCRDSASSEELALVEPGRDSL
PSPGASHLFPTYLARCRQYLQRIPDSLCLEILENIFSLLLITSADLHPEPHLPEDYAEDD
DIEGKGPWGLWSPSESPQHIAATERRSERASMGPRDLAPTGPGCPKGEPKDNSPGPHTHS
FLDLKHFTSSLSGFLADEFAIGAFLSLIQEQLNELSSHRTPEETELLEDQSCWAARDGLQ
GRLHRFSKVLSEAQWRYKVVTSNQSSEEQPSRRYRPTAKRHSSLRRGRRTRRTRADGRER
GSNPSLEGTSSELSTSTSEGSLSAVSGQVEADNRFQPQPQSSIIPMMFSPPESLLASCIL
RGNFAEAHQVVLMFNLKSSPSAGELMFVERYQEVIQELARVEHKIENQNSDGGNNTVRRT
GSGRSTLQAIGSAAAAGMVFYSISDVTDKLLSPSEDPIPTLQEDFWINAALTETNTPLRG
VLEDLSPPAMAAFDLACCQCQLWKTCKQLLETAERRLSSSLEGRGRRLDQVVLNPDGMRG
FPFVLQQISKILSYPLTVTGLTKSETLEERGGGAPRCSISELLQMCWPSLTEDCIASHTS
LSQQLDQALQSLREALTLSEPKSTPLTCLVEQAAQKAPEAEAHPVHIQSQLLQKTLGKQT
LAGPRQTDYVGAFFSYCSSLAKVLLRSLSSDPDNVEVKVGNPFVLLQQSSSQLVSHLLLE
RQVPPDRLAALLAQEHLNLSVPQVIVSCCCEPLTLCLSRQSQQASSLTAHLGMLAQGHAS
HLLDGLPLSVLGSPRPSENPSAERKSDSSPKDSLPAFTASALAFLKSRSKILAMVACLRA
SRGTKVSRPSLSWKELRGRREAPLTAEKVAQECEHLLEQFPVFEAALLANWEPLQQASES
RPSLAASLCGQARLSTVLLGLHSTLAQDVVTEAFEEALVARDWPRALQLIDVYGQDSDDL
SSVRDSVLTCATVCDKEGWQYLFPVKDASLRSQLALRFVDKWPLESCLEILAYCVSDMAV
PEELKSELQRKLTELRVYQKILGLQDPPVWCDWQTLRSCCAEDPSTVMDMMLGSQEYELC
EEWGCLYPIPREHLVSLHHKHLLYLLERREYEKALQLLQRIPDPTMCLEVTERSLDQHPS
LATSHFLANYLTSHFYGELTTDRHHEIQALYMGSKVLLTLPEQHRASYAHLSSSPLLMLE
QLLMNMKVDWATTAVQTLQQLLAGQDIGFTLDEVDSLLSRYAGKALDLPYPLREKRSDSM
IHLQEPVHQASDPETLSRSSSAEFSAAAAAPAPAAPGSALVCSPSPKERAFPQTQPPLEF
VPPETPPARDQWVPDETESMCMVCCREHFTMFNRRHHCRRCGRLVCGSCSTKKMVVEGCR
ENPTRVCDQCYSYYNKDAPEESPCQSEVPDSAKNESPSYSAVVRIPKATEVEWILSLNEE
ENELVRSEFYYEQAPSASLCIAILNLHRDSIACGHQLIEHCCRLSRGLTNPEVDAGLLID
IMKQLLFSAKMMFVKAGQSQDLALCDSYISKVDVLHILVAAAYRHMPSLDQILQPASVTR
LRNQLLEAEYYQLGVEVSTKTGLDSTGAWHAWGMACLKAGNLTAAREKFSRCLKPPLDLN
QLSHGSRLVQDVVEYLESTVRPLVSLQDDDYFATLRELEATLRTQSLFLEAIPDGKIMNN
TYYQECLFYLHNYSTNLAIISFYMRHNCLREALLHLLNKESPAEVFIEGIFQPSYKSGKL
HTLENLLESIDPTLESWGAYLIAACQHLQKKNYYHILYELQQFMKDQVRAAMTCIRFFSH
KAKSYTELGEKLSWLLKAKDHLKIYLQENSRSSGRKKTTFFRKKMAAADVSRHMNTLQLQ
MEVTRFLHRCESARTSQITTLPLPTLFGNNHMKMEVACQVMLGGKNVEDGFGIAFRVLQD
FQLDAAVTYCRAARQLVEKEKYGEIRQLLKCVSESGMAAKSDGDTILLNCLEAFKRIPPQ
ELEGLIQAIHSDDNKVRAYLTCCKLRSAYLIAVKQEHTQAAALVQQVQQAAKSSGDSVVQ
DICAQWLLTSHSRGAHGSGSRK
NT seq 7629 nt NT seq  +upstreamnt  +downstreamnt
atgagttacccatttgggaaagaggaaaccactacagagaagcagctttttgaatttttc
tgtgagtgcctgcggaggggagactgggagttggcacaagcatgtgtacctcaactacaa
agggggcaaggagagatcccccaaaaggtggaggacatactacaggcactggtacagtgt
cccattctgctaagatgtgggccagacatcaaccctcaaagattagcctggctctggctt
ctcgtattagaaaaatggttgcccccagaaaagaaattactttctactgttttccggaga
aaacttgagtttctgtttttgtcagaagacctccaaggtggcattccagagaccatcctc
aaggagctgtttgaaaccttagcacaaggcccagcaggctgtacatctgacagaagtcaa
agatgggagagcggggcccctcagctcagccctgaagctgtctccatgctctggaatctt
ctgaagcaagcccccgggccagcccaggccctgttggagctgctgcttgaggaacgccac
agtgccagtctctgtcatagttctctgcagaagtccctgctggacctcatccgaaaggcc
ttgcagaccctgcgggaccctgcctctcagcccgctggggtgaccgacgctgtctgtgga
gcccttcaggctctgtgttgcactgctgagctaccagagggcgaatggcacgtcctatgt
gaggagctgttggagacctgcagaactgagggcagtcccctgaaggaggaacggctactt
ggttgcctgttgcacaaggctggacggagcctactgtccctctatggccacacctatgca
gagaaggtggcagaaaggccaccaaaggcctcactttcaggaaaagatcatcctgatcct
gagcgggcgatgctggccctgttctccactcctgacccagcccacgcgtggaaaatggcc
tttttctactgcctgagtaacaacaaacacttcctggagcagatccttgtaacggcactg
accctgttgaaagaggaagatttcccaagccttggatacctgcttgatagagaattcagg
cctctcagtcacctgctcgtgctcctgggctggacacactgccagagccttgaatcagct
aagagactactccagactctctacaggaaccaggaccaaggccatgatgagcttctcagg
gatgcctgtgaaggattgtgggctcacttagaagtcttggagtggtgtgtacagcagagc
agcagcctcataccaaagagagagctcttgtgtcacttacatggtggagacagccactca
gtgctctactctctccatcaccttacaaaccttccagccctcagggaggaagaagtcctc
aagctgttacagaaggtgccaaccaaggacctccagggagagcatgatacccatgatgcc
tcagtccctgaacacctgagccagtgtcagagcttgaccctctaccaaggcttctgtgcc
atgaagtatgcggtctacgccctctgtgtgaactcacatcagcactctcagtgtccggac
tgcagagacagtgcctcctctgaggagctggccttggtggagccaggcagggattctctc
ccttccccaggtgcttcacatctcttcccaacatacctggccaggtgccgacagtattta
cagcgcatccccgactctctgtgcctggaaattctcgaaaacatcttctcgttgctcctc
attacctccgccgaccttcaccccgagcctcacctgccagaggactatgccgaggacgat
gacatcgaggggaaaggcccttggggtttgtggtctccatcagagagccctcagcacata
gctgcaactgagaggaggtcagagcgggcttccatgggacccagggaccttgctcctaca
gggccaggctgtccaaagggagaaccgaaagacaattcaccagggcctcacacacacagc
tttttggacctgaagcactttaccagtagcctgagtggattcctggctgacgagtttgca
ataggagctttcctcagccttattcaggagcagctcaatgagctcagcagccacaggact
cccgaggagacagaactactggaagaccagagctgttgggcagccagagatggactgcag
ggccgcctgcacaggttctcaaaggttctctccgaggcacagtggcggtacaaagtggtt
acaagcaaccagagctcagaagagcaaccttcccgaagatatcggcccactgccaagagg
cattctagtctccgccgaggtcgtaggaccagaaggacccgggcagatggccgggaacga
ggctccaacccttccctggaaggtacaagtagtgagctgagcacaagtacttcagaaggg
agtctgagtgctgtgtctgggcaggtggaggcagacaaccggtttcagccccaacctcag
agttcgatcatccctatgatgttctccccgccagagtctctgctggcatcctgcatcctc
agggggaactttgcagaagcccatcaggtggtgctcatgttcaacctgaagtcctcacct
agtgccggggagctgatgtttgtagagcgctaccaagaggtgatccaggagctggcccga
gtggaacacaagattgagaaccagaattctgatgggggtaacaacaccgtccggcgcact
ggcagtgggcgctcgactctacaggccattggcagtgctgcagcagcaggaatggtattt
tactccatctctgatgtgactgacaagctcctcagcccctccgaagaccccatccccaca
ctccaggaggatttttggataaatgctgctctcacagaaaccaacactcctcttagaggg
gtcctggaagacctcagccccccagccatggctgcatttgacctagcttgttgccagtgc
cagctctggaagacctgcaaacagctcttagaaacagctgagcggcgactcagcagcagc
cttgagggccggggtcgaaggctagaccaggtcgtcctgaatcctgatgggatgcgaggt
tttccatttgtcctgcagcaaattagtaagattctcagttatccccttacggtaacagga
ctaacaaaatcagagactctagaagaaagaggaggaggcgctccacggtgcagcatctct
gagctgcttcagatgtgctggcccagcctcactgaagattgcattgccagccataccagt
ctttcccaacagctagatcaggctctccaatcgctgcgagaggctttaacgctgtcagag
cccaagagtactccactcacttgcctagtggagcaggcagcccagaaagcccctgaggca
gaggcccaccccgtgcacatccaaagtcagctgctccagaagaccctgggaaaacagaca
ctggcaggccctagacagactgactatgtgggagccttcttcagctactgcagcagcctg
gctaaagtcctccttcggagtttgagctcggaccctgataatgtggaggtcaaggttgga
aatccctttgttctcctgcagcagagctcttcccaactggtgtcacatctcctgctcgaa
agacaagttccccccgacaggttggcagctcttcttgcccaagagcatctcaacctaagt
gtgcctcaggtcattgtcagctgctgctgtgagccccttactctttgcctgtctcgacaa
agccagcaggcctcatccctcacggcccatctaggcatgctggctcaggggcacgcctct
caccttctggatggcctgcccctctctgtactgggctcccctagaccgagcgagaatccc
tcagcagaaagaaagtctgattcctccccaaaggattccctcccagccttcaccgcctct
gccttggctttccttaagtctcgctcaaagatactggccatggtggcctgtctgcgggct
tcccgggggacaaaggtcagcagacccagcctgtcttggaaagaacttcgtggtcgcagg
gaggcacctctgactgcagagaaggtagcccaggagtgtgagcaccttctggaacagttt
cctgtgtttgaggccgcccttctggctaactgggagcctctgcagcaagcatctgagtca
agaccaagtctggcagccagtctctgtggtcaggccaggctctctactgtgcttctgggc
ctacattctactctggcccaggatgtagtaactgaggcctttgaggaagctttggtggcc
agagattggccacgggcccttcaactcattgacgtgtatgggcaagactcggacgacctg
agcagtgtacgggattcggtcctgacctgtgctactgtgtgtgacaaggaaggttggcag
tacctgtttcccgtgaaggacgcatccctgagaagtcaactggccctacggtttgtggac
aagtggcccctggagtcctgcctggagatcttggcttactgtgtttcagacatggctgtc
ccagaagaactaaaatctgagctgcagaggaaactgacagagctgcgggtctaccagaag
atcctaggtttacaggatcctccagtgtggtgtgactggcagaccctgaggagctgctgt
gctgaagacccatcaactgtcatggacatgatgctgggatcacaggagtatgaactatgc
gaggagtggggctgtttgtaccccattccaagagaacatttggtcagtctgcatcacaag
catcttctctacctgctagaaagaagagagtatgaaaaggctcttcagctcctgcaacga
atccctgaccctaccatgtgccttgaggtcacagagaggtcccttgaccagcaccctagc
ttagccacttcacacttcttggccaactacctcacctcccacttctatggagaattgacc
actgaccgacaccatgagatccaggcactgtacatgggatctaaggttcttctgaccctc
cctgagcagcaccgggccagctatgcccatttgtcctccagtcctctgctcatgttagag
cagctgctgatgaacatgaaggtggattgggccaccacagccgtgcaaacgctgcagcag
ctgctggctggacaggacattggcttcaccctggacgaggttgactcgttgctctccaga
tacgcagggaaagccctggacctcccgtaccctctgagagaaaaacgatcagattccatg
attcacctccaggagcctgtccaccaagcttcagacccagagaccctgtctaggtcatcg
tcagctgagttctccgctgctgctgctgctcctgctcctgctgctcctggaagtgcctta
gtctgttctcccagtcccaaggagagagctttccctcagactcagccgccactggagttc
gtgcccccagagacacccccggcccgggatcagtgggtcccagatgagacagagagcatg
tgcatggtctgctgcagagagcacttcaccatgttcaacaggcgtcatcactgtcgccgc
tgtgggcggctagtgtgcggttcctgctccaccaagaaaatggtggtggaaggctgcaga
gaaaacccaacacgcgtttgtgaccagtgctacagctactacaacaaagatgcaccagag
gagagcccatgccagtcagaagttccagacagcgctaaaaatgaaagcccttcttattca
gctgtggtgagaatccccaaagcaactgaggtggaatggatcttgagtctaaatgaggaa
gaaaatgagctggtgcgcagtgagttttactatgagcaggcccccagcgcctccctgtgc
attgccatcctgaacctacaccgagacagcatcgcctgtggtcaccagctgattgagcac
tgctgcaggctgtccaggggcctcaccaacccagaggtggacgccgggctgctcatagac
atcatgaagcagctactcttcagtgccaaaatgatgttcgtcaaggctggccagagccag
gacttggctctttgtgacagctacatcagcaaggtagacgtgctgcatattttagtcgct
gctgcctaccgccatatgccgtctctagatcagatcttgcagccggcctcggtaaccagg
ctgaggaaccagctcctggaagcggagtactaccaactgggcgttgaggtctctacaaag
actgggcttgattccacaggagcatggcacgcctggggcatggcctgcctcaaagctggg
aacctcactgctgctagggagaagttcagtcgctgcctgaagcctcctttggacctgaac
caactgagtcatggctcgaggctagtccaggatgtggtggagtacctggagtccacagtg
agacccctcgtttccttgcaagatgatgattactttgccaccttgagggaactagaagcc
acccttcgaacccagagcctcttcctggaggccattcctgatgggaagatcatgaacaac
acttactaccaagaatgtctcttctacctgcacaactacagcaccaacctggccatcatc
agtttctacatgaggcataactgccttcgggaagccctgctgcacctgctcaacaaggaa
agtcctgcagaagtcttcatagaaggcattttccagccaagctataaaagtgggaagctg
cacactttggaaaacttactggaatccattgatccaaccttggagagctggggagcatac
ctgatcgctgcgtgccagcatctgcagaagaagaactactaccacatcctgtacgagctg
cagcagtttatgaaggaccaagtccgagctgccatgacctgtattcggttcttcagtcac
aaagcaaagtcatacacagagctgggagagaagctgtcatggttgcttaaggccaaggac
cacctgaagatctacctccaagaaaactcccgcagctccggaaggaagaaaaccaccttc
ttccggaagaagatggctgccgctgatgtgtccaggcacatgaacacgctgcagctccag
atggaagtgaccagattcttacatcgctgcgaaagtgccaggacctctcagatcaccacc
ctgcctctgccaacactcttcggaaacaaccacatgaaaatggaagttgcctgccaggtc
atgctgggagggaaaaatgtggaagatggttttggaattgcattccgtgttctgcaggac
ttccagctggacgctgctgtgacctactgcagagctgccaggcagctggttgagaaagaa
aaatatggggagattcgacagctgctcaaatgtgtcagtgagtcaggcatggcagccaaa
agcgatggcgacaccatcctcctcaactgcctggaagccttcaagagaattccaccccag
gagctggagggactgatccaggccatccacagcgatgacaacaaggtccgggcctatctg
acgtgttgcaagctgcgttctgcctacctgattgccgtgaagcaagaacacactcaggcc
gccgccctcgtccagcaggtgcagcaggctgccaaaagcagcggggattctgtagtgcaa
gacatctgtgctcagtggcttctgacaagccattcccgtggtgcccatggttcaggctcc
aggaagtga

DBGET integrated database retrieval system