KEGG   Rattus norvegicus (rat): 314312Help
Entry
314312            CDS       T01003                                 

Gene name
Entpd5, Pcph
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 5
  KO
K01511  ectonucleoside triphosphate diphosphohydrolase 5/6 [EC:3.6.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    314312 (Entpd5)
   00240 Pyrimidine metabolism
    314312 (Entpd5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.6  nucleoside diphosphate phosphatase
     314312 (Entpd5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 zf-rbx1
Motif
Other DBs
NCBI-GeneID: 314312
NCBI-ProteinID: NP_955426
RGD: 735219
Ensembl: ENSRNOG00000033206
UniProt: Q6P6S9
Position
6q31
AA seq 427 aa AA seqDB search
MATSWASVFLLIIAYVGGTVFYREQQTWFEGVFLSSMCPVNVSAGTFYGIMFDAGSTGTR
IHVYTFVQRTSGQLPFLEGEIFDSVKPGLSAFVDQPKQGAETVQELLEVAKDSIPRSHWK
RTPVVLKATAGLRLLPEQKAQTLLLEVEEIFKNSPFLVPDDSVSIMDGSYEGILAWVTVN
FLTGQLHGRGQETVGTLDLGGASTQITFLPQLEKTLEQTPKGYLASFEMFNSTFKLYTHS
YLGFGLKAARLATLGALEAEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEMGFE
PCYAEVRRVVQGKLHQPEEIRGSSFYAFSYYYDRAAETHLIDYEKGGVLKVEDFERKARE
VCDNLESFSSGSPFLCMDLSYITALLKDGFGFEDGTLLQLTKKVNNIETGWALGATFHLL
QSLGITS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtcctgggcgtccgtcttcttgctgatcatagcctatgttggtggcactgtc
ttctacagagaacagcagacttggtttgagggtgtcttcttgtcttccatgtgccccgtt
aatgtcagtgccggcaccttttatggaatcatgtttgatgcgggcagcactggaactcgg
attcacgtttacacctttgtgcagagaacatcaggacagctcccctttctggaaggtgaa
atttttgattctgtgaagccgggactttctgcttttgtggatcaacccaaacagggtgct
gagactgttcaagaactcttagaggtggccaaggactcaatccccagaagtcactggaag
cggacgccagtggttctgaaggcaacggctggactgcgattgctgccagaacagaaagcc
cagaccctgctcttggaggtagaggagatcttcaagaattcacctttcctggtcccggat
gacagcgttagcatcatggatgggtcctatgaaggcatattagcttgggttaccgtgaac
tttctaacaggtcagctgcatggccgtggccaggagactgtggggacccttgacctgggg
ggtgcctccacccaaatcacgtttctaccgcagttggagaaaaccctggaacaaacacct
aagggctacctcgcttcctttgagatgtttaacagcacttttaagctctatacgcatagt
tacttgggatttggactgaaagctgcaagactagcgactctgggagctctggaagcagaa
gggactgatggacatactttccgaagtgcctgtttaccaagatggttggaagcagagtgg
atctttgggggtgtgaaatatcagtatggtggtaaccaagaaggggagatgggctttgag
ccctgctatgcagaagtgcggagggtagttcaaggaaaacttcaccagccagaagagatt
cgaggaagctccttttatgctttctcctactattatgatcgagctgccgagacacacttg
attgattatgaaaaggggggtgttttgaaggttgaagattttgaaagaaaagccagggaa
gtgtgtgacaacttggagagcttctcctcaggcagtcctttcctctgcatggacctcagt
tacatcacagccttattgaaagatggctttggctttgaggatggcaccctcttacagctc
acaaagaaagtgaacaacatagagactggttgggccttgggagccacctttcacctgctc
cagtccctgggtatcaccagctga

DBGET integrated database retrieval system