KEGG   Rattus norvegicus (rat): 314322Help
Entry
314322            CDS       T01003                                 

Gene name
Fos, c-fos
Definition
(RefSeq) FBJ osteosarcoma oncogene
  KO
K04379  proto-oncogene protein c-fos
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04024  cAMP signaling pathway
rno04210  Apoptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04668  TNF signaling pathway
rno04713  Circadian entrainment
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04935  Growth hormone synthesis, secretion and action
rno05031  Amphetamine addiction
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease (American trypanosomiasis)
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05224  Breast cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05323  Rheumatoid arthritis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    314322 (Fos)
   04668 TNF signaling pathway
    314322 (Fos)
   04024 cAMP signaling pathway
    314322 (Fos)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    314322 (Fos)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    314322 (Fos)
   04660 T cell receptor signaling pathway
    314322 (Fos)
   04658 Th1 and Th2 cell differentiation
    314322 (Fos)
   04659 Th17 cell differentiation
    314322 (Fos)
   04657 IL-17 signaling pathway
    314322 (Fos)
   04662 B cell receptor signaling pathway
    314322 (Fos)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    314322 (Fos)
   04917 Prolactin signaling pathway
    314322 (Fos)
   04921 Oxytocin signaling pathway
    314322 (Fos)
   04926 Relaxin signaling pathway
    314322 (Fos)
   04935 Growth hormone synthesis, secretion and action
    314322 (Fos)
   04928 Parathyroid hormone synthesis, secretion and action
    314322 (Fos)
  09156 Nervous system
   04725 Cholinergic synapse
    314322 (Fos)
   04728 Dopaminergic synapse
    314322 (Fos)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    314322 (Fos)
  09159 Environmental adaptation
   04713 Circadian entrainment
    314322 (Fos)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    314322 (Fos)
   05231 Choline metabolism in cancer
    314322 (Fos)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    314322 (Fos)
  09162 Cancer: specific types
   05210 Colorectal cancer
    314322 (Fos)
   05224 Breast cancer
    314322 (Fos)
  09163 Immune disease
   05323 Rheumatoid arthritis
    314322 (Fos)
  09165 Substance dependence
   05031 Amphetamine addiction
    314322 (Fos)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    314322 (Fos)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    314322 (Fos)
   05135 Yersinia infection
    314322 (Fos)
   05133 Pertussis
    314322 (Fos)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    314322 (Fos)
   05170 Human immunodeficiency virus 1 infection
    314322 (Fos)
   05162 Measles
    314322 (Fos)
   05161 Hepatitis B
    314322 (Fos)
   05167 Kaposi sarcoma-associated herpesvirus infection
    314322 (Fos)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    314322 (Fos)
   05142 Chagas disease (American trypanosomiasis)
    314322 (Fos)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    314322 (Fos)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    314322 (Fos)
   04131 Membrane trafficking [BR:rno04131]
    314322 (Fos)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    314322 (Fos)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    314322 (Fos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Motif
Other DBs
NCBI-GeneID: 314322
NCBI-ProteinID: NP_071533
RGD: 2626
Ensembl: ENSRNOG00000008015
UniProt: P12841
Position
6q31
AA seq 380 aa AA seqDB search
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVTSLDLTGGLPEATTPESEEAFT
LPLLNDPEPKPSLEPVKNISNMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYA
ADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctcgggtttcaacgcggactacgaggcgtcatcctcccgctgcagtagcgcc
tccccggccggggacagcctttcctactaccattccccagccgactccttctccagcatg
ggctcccctgtcaacacacaggacttttgcgcagatctgtccgtctctagtgccaacttt
atccccacggtgacagccatctccaccagcccagacctgcagtggctggtgcagcccact
ctggtctcctccgtggccccatcgcagaccagagcgccccatccttacggactccccacc
ccgtcgaccggggcttacgccagagcgggagtggtgaagaccatgtcaggcggcagagcg
cagagcatcggcagaaggggcaaagtagagcagctatctcctgaagaggaagagaaacgg
agaatccgaagggaaaggaataagatggctgcagccaagtgccggaatcggaggagggag
ctgacagatacgctccaagcggagacagatcaacttgaagacgagaagtctgcgttgcag
accgagattgccaatctactgaaagagaaggaaaaactggagtttattttggcagcccac
cgacctgcctgcaagatccccaatgacctgggcttcccagaggagatgtctgtgacctcc
ctggacttgactgggggtctgcctgaggctaccaccccagagtctgaggaggccttcacc
ctgcctcttctcaatgaccctgagcccaagccatccttggagccggtcaagaacattagc
aacatggagctgaaggctgaaccctttgatgacttcttgtttccggcatcatctaggccc
agtggctcggagactgcccgctctgtgccagatgtggacctgtctggttccttctatgca
gcagactgggagcctctgcacagcagttccctggggatggggcccatggtcacagagctg
gagcccctgtgcactcccgttgtcacctgcactcccagctgcactacctatacgtcttcc
tttgtcttcacctaccccgaggctgactccttccctagctgcgcagctgcccaccgaaag
ggcagcagcagcaacgagccctcctctgactcactgagctcgcccacactgctagccctg
tga

DBGET integrated database retrieval system