KEGG   Rattus norvegicus (rat): 314329Help
Entry
314329            CDS       T01003                                 

Gene name
Irf2bpl, Eap1, Pqcp, RGD1310994
Definition
(RefSeq) interferon regulatory factor 2 binding protein-like
  KO
K22383  interferon regulatory factor 2-binding protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    314329 (Irf2bpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-2BP1_2 zf-C3HC4 DUF2722 SUIM_assoc zf-C3HC4_2 Spt20
Motif
Other DBs
NCBI-GeneID: 314329
NCBI-ProteinID: NP_001012488
RGD: 1310994
Ensembl: ENSRNOG00000011026
UniProt: Q5EIC4
Position
6q31
AA seq 783 aa AA seqDB search
MSAAQVSSSRRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRA
HGCFQDGRSPGPPPPVGVKTVALSAKEAAAAAAAAQQQQQQQQQQQQQQQQQPQQLNHVD
GSTKPAVLPAPSGLERYGLSAAAAAAAAAAAAVEQRSRFEYPPPPVSLGSSSHAARLPNG
LGGPNGFPKPAPEEGPPELNRQSPNSSSAATSVASRRGTHSGLVTGLPNPGGGGGPQLTV
PPNLLPQTLLNGPASAAVLPPPHGLGGSRGPPTPAPPGAPGGPACLGGPPGVSATVSSAP
SSTSSTVAEVGVGAAGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRAEEWANKPK
MVRDTLLTLAGCTPYEVRFKKDHSLLGRVFAFDAVSKPGMDYELKLFIEYPTGSGNVYSS
ASGVAKQMYQDCMKDFGRGLSSGFKYLEYEKKHGSGDWRLLGDLLPEAVRFFKEGVPGAD
MLPQPYLDASCPMLPTALVSLSRAPSAPPGTGALPPAAPTGRGAAASLRKRKASPEPPDS
AESALKLGEEQQRQQWMANQSEALKLTMSAGGFAAPGHAAGGPPPPPPPLGPHSNRTTPP
ESAPQNGPSPMAALMSVADTLGTAHSPKDGSSVHSTTASARRNSSSPVSPASVPGQRRLA
SRNGDLNLQVAPPPPSAHPGMDQVHPQNIPDSPMANSGPLCCTICHERLEDTHFVQCPSV
PSHKFCFPCSRESIKAQGATGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKE
RDP
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggcgcaggtgtcctcgtcccggagacagtcttgctacctgtgcgacctgcct
cgcatgccctgggccatgatctgggacttctccgaacccgtatgccgtggttgcgtcaat
tacgaaggcgccgaccgcatagaattcgtgatcgagacagcacgccagctgaagcgggcg
cacggttgcttccaagacggccgctcccccgggccgccgccgccagtcggggtcaagaca
gtggccttgtccgccaaggaagcggcagcagcagctgccgccgctcagcaacagcagcag
caacaacaacagcagcagcagcagcagcagcagcagccacagcagctcaaccacgtcgat
ggctctaccaagcctgcagtgttgcccgccccgtccggtctggagcgctatggcctgagc
gcagcggccgccgcggctgctgccgccgccgccgcggttgaacaacgcagccgtttcgag
tacccgcctcccccggtgagtctggggagcagcagccacgccgcccggctgcccaacggc
ctgggaggtcccaacggcttccccaagccggcaccagaggagggtcccccggagctgaac
cgccagagccccaactcatcctcagcggcaacatcggtggcttctcggcgtgggactcat
agtgggctggtgaccgggctgcccaacccgggtggtggcgggggaccccagctcaccgtg
ccccccaacctattgccgcagacgctgcttaatggcccggccagcgccgcggtactgcct
ccgccccatgggctggggggaagccgagggcccccgactccagcacctccgggtgctcct
ggggggcccgcctgtctcgggggtcccccgggtgtgtcggccactgtatcctctgctccg
tcatcgacctcgtcgacagtggcagaggtgggcgtgggtgctgctggtaagaggcctgga
tcggtgtcgagcacagaccaggagcgtgagctaaaggaaaagcagcgcaacgctgaggcc
ttggccgagctgagcgagagcctgcgcaaccgcgcggaggagtgggctaacaagcccaag
atggtccgtgacacgctgctcacgctggctggctgcacgccctacgaggtgcgcttcaag
aaggaccattcgctgttgggtcgtgtctttgccttcgacgcggtctctaagcccggcatg
gactacgagctgaagctgttcattgagtatcccacgggctccggcaatgtgtactccagc
gcgtctggggtggccaaacagatgtaccaggattgcatgaaggactttggccggggtctg
tcctctggcttcaaatacctggagtacgagaaaaagcatggctctggcgactggcgcctt
cttggggacctactgcccgaagctgtgcgcttcttcaaggagggcgtgcccggcgcggac
atgctgccccagccctacctagatgccagttgtcccatgctacccacggcgctggtgagt
ctcagccgcgcccccagcgcacctccaggaactggagccttgccacccgcggcgcccacg
ggccggggtgcagcagccagcctgcgcaaaaggaaggcatccccggagcctccagactca
gctgaaagcgcactgaagctcggtgaggagcagcagaggcagcagtggatggcaaaccag
agcgaggcgctgaagctcactatgtccgcggggggctttgcggcgccgggacacgcagca
gggggaccgcctccaccccctccacctctgggacctcattccaatcggaccaccccgccc
gagtcagccccccagaacggtccgtcccccatggccgcgctcatgtcagtagcagacact
ttgggcacagcgcattcgcccaaggatggcagttcagtgcactccaccactgcatctgct
aggcgaaacagcagcagcccggtgtcgcctgcctccgtgccggggcagcgtcgcctggca
tcacgcaatggggacctgaatttacaggtggcacccccaccgcctagcgcccacccgggc
atggaccaagtgcacccccaaaacattccggattcccctatggccaacagcgggcccctc
tgctgtaccatttgccacgaacgtttggaggacactcatttcgttcagtgtccatccgtc
cctagccacaaattttgtttcccttgttctagagagagtatcaaagcccagggggccaca
ggtgaggtgtattgccccagcggagagaaatgccccctagtcgggtctaatgtaccttgg
gccttcatgcagggcgaaatcgcaactatcttagctggggatgttaaagtgaaaaaagag
agagacccttga

DBGET integrated database retrieval system