KEGG   Rattus norvegicus (rat): 314360
Entry
314360            CDS       T01003                                 

Gene name
Galc
Definition
(RefSeq) galactocerebrosidase precursor
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    314360 (Galc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    314360 (Galc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     314360 (Galc)
SSDB
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Other DBs
NCBI-GeneID: 314360
NCBI-ProteinID: NP_001005888
RGD: 1359384
Ensembl: ENSRNOG00000003759
UniProt: A0A0G2QC23
Position
6
AA seq 668 aa
MTAAAGSASRVAVPLLLCAMLAPSGAYELDDSDGLGLEFDGIGAVSGGGATSRLLVNYPE
PYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKE
AKKRNPNIILMGLPWSFPGWLGKGFSWPYVNLQLTAFYIVRWILGAKHYHDLDIDYIGIW
NERPFDANYIKELRKMLDYEGLQRVRIIASDNLWEPISSSVLLDQELWKVVDVIGAHYPG
TYTVWNAKMSGKKLWSSEDFSTVNSNVGAGCWGRILNQNYINGNMTATIAWNLVASYYEE
LPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDG
LGNFTIIVETMSRQHSMCIRPYLPYYNVSRQLATFILKGSLKEIQELQVWYTKLGTTPEK
LHFKQLETLWLLDGSGSFSLELEEDEMFTLTTLTTGHKGSYRPPPKSQPFPTSYKDDFNV
EYPLFSEAPNFADQTGVFEYYTNNEDLEHRFTLRQVLNQRPITWAADASSTISVIGDHHW
SNMTVQCDVYIETPRTGGVFIAGRVNKGGILIRTASGVFFWIFANGSYRVTADLGGWITY
ASGHADVTAKRWYTLTLGIKGYLASGMLNGKILWENVPVKYPGHGWAAIGTHTFEFAQFD
NFHVEAAR
NT seq 2007 nt   +upstreamnt  +downstreamnt
atgaccgccgccgcgggctcggcgagccgtgtcgcggtgcccttgttgttgtgcgcgatg
ctggcgcccagcggcgcctacgagctagacgactccgacgggctgggcctggagttcgat
ggcatcggcgcagtcagcggcggcggggcaacctcccggcttctagtaaattacccagag
ccctatcgttctgaaatactggattatctatttaagccaaacttcggtgcctctctgcat
attctaaaagtggaaataggtggcgatggacaaacaacagacggcactgaaccctcccac
atgcactatgagctagatgagaattatttccgaggctatgagtggtggctaatgaaggaa
gctaagaagaggaacccaaatattatacttatggggttgccatggtcattccctggatgg
ctgggcaaaggcttcagttggccttatgtaaatcttcagctgactgccttctatattgtg
agatggattttgggtgccaagcattatcatgacctggacattgattatattgggatatgg
aatgaaaggccgtttgatgccaactatataaaggaattaagaaaaatgcttgattatgaa
ggtctccagcgagtgagaatcatagcaagtgataatctctgggagccaatttcctcttct
gtgctgcttgaccaggagctctggaaggtggttgatgttataggagctcattatcccgga
acctacacagtctggaatgcaaagatgtcagggaagaagctttggtcgtcggaagacttt
agcactgtcaacagtaatgttggcgcaggctgttggggtcgcatattgaaccagaattac
atcaacggcaatatgaccgccacaattgcttggaatttggtggctagttactatgaagaa
ttgccctatggacgaagtggattgatgacagcccaggagccgtggagtggacattatgta
gtagcatctcctatctgggtatcagctcatacaactcaatttactcaaccaggctggtat
tacctgaagacagttggccatctagagaaaggaggaagctatgtagctctgactgatggc
ttggggaatttcaccatcatcgttgaaactatgagtcgtcaacattctatgtgtatacgg
ccatatctaccgtattataatgtctcacgtcagctggccaccttcattctaaaggggtct
ttgaaagaaatacaagagctgcaggtgtggtacaccaagcttggaacaacaccagagaaa
cttcattttaaacaactggaaactctatggctccttgacggcagcggcagtttctcactg
gaactggaggaggatgagatgttcacactcaccactctgaccacagggcacaaaggcagc
taccgtccccctcccaagtcacagcccttcccaaccagctataaggatgatttcaacgtt
gagtacccattatttagtgaagctccgaattttgctgatcagaccggcgtgttcgagtac
tacacgaataacgaagaccttgagcatcgcttcacactgcgccaagttctcaaccaacga
cctattacctgggccgcggatgcctccagcacgatcagtgtcataggcgatcaccactgg
agcaacatgactgtgcagtgtgatgtttacatagagactcctcggactggcggtgtgttc
attgctggaagagtgaataaaggtggtatcttgatcagaactgcttcaggagttttcttc
tggatttttgcaaatggctcttacagagttacagccgacctgggtgggtggataacatat
gcttcaggacatgctgacgttacagcaaagcgatggtatacactcaccttaggcattaag
ggttatctcgcctctggtatgttgaacggcaagatcctgtgggaaaatgtgcccgtgaaa
tacccagggcatggctgggctgcgatcggaacgcataccttcgagtttgcgcagtttgac
aactttcatgtggaagctgctcgctaa

DBGET integrated database retrieval system