KEGG   Rattus norvegicus (rat): 314386Help
Entry
314386            CDS       T01003                                 

Gene name
Gpr68
Definition
(RefSeq) G protein-coupled receptor 68
  KO
K08408  ovarian cancer G-protein coupled receptor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    314386 (Gpr68)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Proton-sensing GPCRs
    314386 (Gpr68)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srw DUF1673
Motif
Other DBs
NCBI-GeneID: 314386
NCBI-ProteinID: NP_001101519
RGD: 1309559
Ensembl: ENSRNOG00000046309
UniProt: D3ZSW1
Position
6q32
AA seq 375 aa AA seqDB search
MRSKAPSGPKMGNITTENSSLPCPIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQI
KARNELGVYLCNLTIADLFYICSLPFWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVG
FLCCISIDRYLAVAHPFRFHQFRTLKAAVGVSVLIWAKELLTSIYFLKHKEVIEDEDRHR
VCFEHYPIQAWQRGINYYRFLVGFLFPICLLLASYQGILRAVRRSHGTQKSRKDQIQRLV
LSTVVIFLACFLPYHVLLLVRSLWESSCDFAKSIFNIYHFSLLLTSFNCVADPVLYCFVS
ETTHRDLARLRGACLAFLTCSRTSRAREAYPLGAPEASGKSGAQGEEPELLTKLHSAFQT
PNSLGLGGPPTVGLA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtaaggccccttctggcccaaagatggggaacatcactacagaaaactcctca
ctaccttgccccattgaccacaccatccaccagacactggccccagtggtctatgtgacc
gtgctggtggtgggcttcccggccaactgcctatccctctactttgggtacttgcagatc
aaggcccgaaatgagctgggagtgtacctgtgtaacctgaccattgcagacctattctat
atctgttcgctccccttctggctgcagtacgtactccagcatgacaactggtcccacggt
gacctatcctgccaggtgtgtggcatcctcctctatgagaacatttacatcagcgtgggc
ttcctctgctgtatctccatcgaccgctacctggctgtggcccaccccttccgcttccac
cagttccgcaccctgaaggcagccgtgggtgtcagtgtgctcatctgggccaaggagctg
ctgaccagcatctacttcctcaagcacaaggaggtcatcgaagacgaggaccggcaccga
gtctgctttgagcattaccctatccaggcgtggcagcgtggcatcaactactaccgtttc
ctggtgggctttctctttcccatctgcctgctgctggcctcctaccagggcatcctgcgg
gctgtgcgccgcagccatggcacccagaagagccgcaaggaccagattcagcggctggtg
ctcagcaccgtggtcatcttcctggcttgcttcctgccctaccacgtgctgctgctggtg
cgcagcctctgggagagcagctgtgactttgccaagagcatcttcaacatctatcacttc
tccctcctcctcaccagcttcaactgtgtagctgacccggtgctgtactgctttgtcagt
gagaccactcacagggacctagcccgcctccgaggagcctgcctagccttccttacctgc
tctaggacaagcagggccagggaggcctaccctctgggtgcccctgaggcctctgggaaa
agtggggcccagggcgaggagcctgaattgttaaccaagctccactcagccttccagacc
cctaactcactgggattgggagggccccccacagttggcttggcctag

DBGET integrated database retrieval system