KEGG   Rattus norvegicus (rat): 314432
Entry
314432            CDS       T01003                                 

Gene name
Uba1, Ube1x
Definition
(RefSeq) ubiquitin-like modifier activating enzyme 1
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    314432 (Uba1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    314432 (Uba1)
   05022 Pathways of neurodegeneration - multiple diseases
    314432 (Uba1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    314432 (Uba1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    314432 (Uba1)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     314432 (Uba1)
Ubiquitin system [BR:rno04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   314432 (Uba1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   314432 (Uba1)
  Exosomal proteins of other body fluids (saliva and urine)
   314432 (Uba1)
  Exosomal proteins of colorectal cancer cells
   314432 (Uba1)
SSDB
Motif
Pfam: ThiF UBA_e1_thiolCys E1_UFD E1_FCCH E1_4HB
Other DBs
NCBI-GeneID: 314432
NCBI-ProteinID: NP_001014102
RGD: 1359327
Ensembl: ENSRNOG00000019164
UniProt: Q5U300
Position
Xq11
AA seq 1058 aa
MSSSPLSKKRRVSGPDPKPGSNCSSAQSVLSEVSSVPTNGMAKNGSEADIDESLYSRQLY
VLGHEAMKMLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTTQWADLSSQFYLRE
EDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNSPLEEQLRVGEFCH
SRGIKLVVADTRGLFGQLFCDFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARH
GFETGDFVSFSEVQGMVQLNGCQPIEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKK
ISFKSLPASLAEPDFVMTDFAKYSRPAQLHIGFQALHQFCAQHNRPPRPRNEEDATELVT
LAQAVNARSPPAVQQDNVDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPI
MQWLYFDALECLPEDKEALTEDKCLPRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIG
CELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMN
PYIQVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGT
LGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQPA
ENVNQYLTDSKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWGDCVTWACHHWHTQYCN
NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNTLHLDYVMAAANLFAQTYGLTG
SQDRAAVASLLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLP
GFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDISPADRHKSKLIAGKIIPAIATTTAA
VVGLVCLELYKVVQGHQQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
QGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVS
RVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR
NT seq 3177 nt   +upstreamnt  +downstreamnt
atgtccagctcgccgctgtccaagaaacgtcgcgtgtccgggcctgatccaaagccaggt
tctaactgctcctctgcacagtcagtgctgtccgaagtgtcttcagtgccaaccaacgga
atggcgaagaacggcagtgaagcagacatagacgagagcctttactcccggcagctgtac
gttttgggccatgaggcaatgaaaatgctccagacatccagtgtcctcgtctcaggcttg
cggggcttaggtgtcgagattgctaagaacatcatccttggtggggtcaaggctgtcacc
ctacatgaccaaggcactacacagtgggctgatctctcctcccagttttaccttcgggag
gaggacattggtaaaaatcgagctgaggtatcccagccccgacttgctgaactcaacagc
tatgtacctgttactgcctacactgggcctcttgttgaagacttccttagtggtttccag
gtggtggtccttaccaacagccccctggaagaacagcttcgagtgggtgagttctgtcat
agccgtggcatcaagctagtggtggcagatacaagaggcctatttgggcaacttttctgt
gattttggagaggaaatggttctcacagattccaatggggagcagccactcagtgctatg
gtttcaatggtcaccaaggacaaccccggtgtggttacctgccttgatgaggcccgacat
ggctttgagactggtgacttcgtctcattctcagaagtacagggcatggtccaactcaat
ggatgtcagcccatagagatcaaagtgctgggtccttatacttttagtatctgtgacacc
tccaacttctctgactacatccgtggaggcatcgtcagccaggtcaaagtacctaaaaag
attagctttaaatccttgccagcatcactggcagagcctgactttgtgatgactgacttt
gccaagtattctcgccctgcccaactgcacattggctttcaagctctgcaccaattctgt
gctcagcacaaccgaccacctcgaccacgaaatgaggaagatgcaacagaactggtgacc
ctagctcaggctgtgaatgctcggtccccacctgcagtacaacaggacaacgtggatgaa
gaccttattcggaagctagcttatgttgctgctggggacctggcacctataaatgctttc
attgggggcctcgctgcccaggaagtcatgaaggcctgttctggaaagtttatgcccatc
atgcagtggttgtactttgatgctcttgaatgtctcccagaggacaaagaggctctgaca
gaggacaagtgcctcccacgtcagaaccgttatgatgggcaggtagctgtatttggctca
gaccttcaagagaagctgggcaagcaaaagtacttcctggtgggtgcaggggccattggc
tgtgaattgctcaagaactttgccatgattgggttaggctgtggagagggtggagaggtc
gtggtcacagacatggacaccattgagaaatcgaatctgaaccgacagtttcttttccgg
ccctgggatgtcacgaagttaaagtctgacacggccgctgcagctgtgcgacagatgaat
ccttacatccaggtgacaagccaccagaaccgtgtaggccctgacacggagcgcatctat
gatgatgattttttccaaaatttggatggtgtggccaatgcactggacaatgtagatgcc
cggatgtacatggatcgccgctgtgtgtactatcggaagccactgctagagtctggcaca
ctgggcacaaagggcaatgtgcaggtggtgatccccttcctgacagaatcatacagctct
agccaggacccaccagagaaatccatccccatttgtaccctgaaaaactttcccaatgcc
atcgaacacactctacagtgggcccgggatgaatttgaaggccttttcaagcagccagca
gaaaatgttaatcagtacctcacagactccaaatttgtggagcggacattgcggctggcg
ggtacccagccattggaggtgctggaggctgtgcagcgcagcctggtgctgcagcgacca
cagacttggggcgactgtgtgacctgggcctgccaccactggcacacccagtactgtaac
aacatacggcagctgctgcacaactttcctcccgaccagctcaccagctcaggggcccct
ttctggtctggacccaaacgatgtccacacccacttacttttgatgttaacaatacattg
catctggattatgtgatggctgctgccaacctttttgcccagacctatgggttgactggc
tcccaagaccgagctgctgtggcctcactcctacagtcagtacaagttccagagttcacc
cccaagtctggtgtcaagatccatgtttctgaccaggagttgcagagcgccaatgcctct
gttgatgacagccgtctcgaggagctcaaagccacactgccgagcccagacaagttacct
ggatttaagatgtaccccattgattttgaaaaggacgatgacagcaatttccacatggat
ttcattgtggctgcatctaatcttcgggccgaaaactatgatatttcccctgcagaccgg
cacaagagcaagctgatcgcagggaagatcatcccagctatcgccacaaccacagctgct
gtggttggccttgtgtgtctggaactctacaaggtagttcaggggcaccaacaacttgat
tcctacaaaaatggtttcctgaatttggccctgcccttctttgggttttcggaacctctt
gctgcgcctcgtcaccagtactataatcaagagtggacattgtgggatcgctttgaagta
caagggctacagcctaatggtgaggagatgactctcaagcagttccttgattactttaag
acggagcacaaattagagatcaccatgctgtcccagggtgtgtccatgctctattctttc
ttcatgccagctgctaagctcaaggaacggttggatcagccgatgacagagattgtgagc
cgagtgtcaaagagaaagctgggccgccatgtgcgtgcactggtgcttgagctgtgctgc
aacgatgaaagtggcgaggacgtcgaggtcccctatgtacgatatacaattcgctga

DBGET integrated database retrieval system