KEGG   Rattus norvegicus (rat): 314436
Entry
314436            CDS       T01003                                 

Gene name
Elk1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04510  Focal adhesion
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno05140  Leishmaniasis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05213  Endometrial cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    314436 (Elk1)
   04012 ErbB signaling pathway
    314436 (Elk1)
   04014 Ras signaling pathway
    314436 (Elk1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    314436 (Elk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    314436 (Elk1)
   04912 GnRH signaling pathway
    314436 (Elk1)
   04921 Oxytocin signaling pathway
    314436 (Elk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    314436 (Elk1)
   05205 Proteoglycans in cancer
    314436 (Elk1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    314436 (Elk1)
   05213 Endometrial cancer
    314436 (Elk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    314436 (Elk1)
   05161 Hepatitis B
    314436 (Elk1)
   05163 Human cytomegalovirus infection
    314436 (Elk1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    314436 (Elk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    314436 (Elk1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    314436 (Elk1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 314436
NCBI-ProteinID: NP_001101529
RGD: 1598663
Ensembl: ENSRNOG00000010171
UniProt: A4GTP4
Position
X
AA seq 427 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAVAMAPATVHS
GPGDNATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPPLHPRPASVL
PNTTPAGVPAPPSGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLNPGFG
RPQPPEVKVEGPKEELEVTEVGGFSPEAVKAEQEVSPSEGLLARLPAILTENTAQVCGLS
TSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAQGPALTPSLLPTHT
LTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVL
SPGPQKP
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacactgtggcagtttctgctgcagcttctaagagaacaaggtaat
ggccacatcatctcctggacctcacgggatggtggtgagttcaagttggtggatgcagaa
gaggtggcccggctatggggactgcgcaagaacaagaccaacatgaattatgacaagctt
agccgggccttgcgctactactatgataagaatatcatccgcaaggtgagcggccagaag
tttgtctacaagtttgtgtcctacccagaggttgcagggtgctccactgaagactgccca
ccccagcctgaggtgtctgtaacctcggccgtagcaatggcccctgctactgtccattca
ggcccaggggacaatgccactggaaagccaggaacaccaaagggtgcaggaatgacaggc
caaggtggcttagcacgaagcagccggaatgaatacatgcgctcgggcctctattctacc
ttcacaatacagtccctgcagccacagccaccccttcatcctcggcctgcctcagtgctt
cccaacactacccctgcaggagtaccagcacccccctcagggagcaggagcaccagtcca
aaccccttagaagcctgcttggaggcagaagaggctggtctgcccctgcaggttatctta
accccaccagaggccccaaaccagaaatctgaagagttgagtctgaacccaggttttggc
cgtccacaacccccagaagtcaaagtggaggggcctaaggaagaattggaagttacagag
gttggaggcttcagtccagaagctgtcaaagctgaacaagaagtctcaccctcagaaggc
ctgctggctcggctcccagccatcctaacagagaatacagcacaggtgtgtggcctctcc
acctccaccactgagatcacccaaccccagaagggccggaagccccgagacctggaactt
ccacttagcccaagcctgctaggtggccaaggacccgaacggactccaggatcaggaaca
agctctggtcttcaggcacaggggccagcactaacaccatccttgctccccacacatacc
ttgaccccggtgctgctgacacccagctcgctgccccccagcatccatttctggagcact
ctgagtccaattgcaccgcgtagtccagccaagctctccttccagtttccgtccagtggc
agcgcacaggtgcacatcccttccatcagcgtggatggcctctcgactcccgtggtgctc
tccccagggccccaaaagccatga

DBGET integrated database retrieval system