KEGG   Rattus norvegicus (rat): 314459
Entry
314459            CDS       T01003                                 

Gene name
Amn
Definition
(RefSeq) amnion associated transmembrane protein
  KO
K18259  protein amnionless
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    314459 (Amn)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   314459 (Amn)
SSDB
Motif
Pfam: Amnionless
Other DBs
NCBI-GeneID: 314459
NCBI-ProteinID: NP_001101531
RGD: 1308634
Ensembl: ENSRNOG00000009050
UniProt: D3ZFK9
Position
6q32
AA seq 459 aa
MGALGRVLLWLQLCALTRAAYKLWVPNTSFDTASNWNQNRTPCAGDAVQFPADKMVSVLV
RDSHAISDMLLPLNGEFVLASGAAFSAAGGDSDPACNPGAPLLFRNPDRFSWLDPHLWSS
GTQESGIFFVDAERVPCTYDDVLFPRNGSFRVALGPGPNPVHVRSVSAVGQTFTRDEDLA
AFLASREGRLRFHGSGALRVGSQACTDATGCVCGNAETLPWICASLLQPLGGRCPEATCQ
DPVRPQGQCCDLCGAIVSLTHDPTFDLERYRARLLDLFLKQPQYQGLQVAVSKVLRDAHT
EIQVVLLETRPATGAAGQLGHALLQDAVAQGSVLGIVSATLRQSGKPTAANSALDQNGSG
AGLAGGVAAVVLLALVGTVLLLLHRSGRLRWRRHGDAEPTSAGLPLGFRNPIFDVMVFKQ
QQASVEFADSTQKVDILDIDTNFGCFVNPLFAGEAEAEA
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgggtgccctgggccgggtgctgctgtggctgcagctctgtgcactgactcgggccgcc
tacaaactttgggtccccaacacttccttcgataccgcctccaactggaaccagaaccgg
accccgtgcgcgggagatgcggtccagttcccggcggacaagatggtgtcggtcctggtg
cgagacagtcacgccatctcggatatgctcctgccgctgaacggggagttcgtcctggcc
tcgggagctgcattcagcgctgcaggaggcgactccgacccggcttgtaaccctggcgcc
ccgttgctcttccgcaatcccgaccgcttctcctggcttgaccctcacctatggagctcc
ggaacccaggagtctggcatcttcttcgtggacgccgagcgcgtgccctgcacctacgac
gacgtcctcttcccgcgcaacgggtctttccgcgtggcgcttggcccaggccccaacccg
gtgcacgtccgcagcgtctcggccgtgggtcagacgttcacgcgcgacgaggacctggcc
gctttcctggcgtcccgcgagggccgcctgcgcttccacgggtcgggcgcgctgagagtg
ggctcccaggcctgcaccgacgcgacgggctgcgtctgcggcaacgccgagacgctgccg
tggatctgcgcgtctctgctgcagcccctgggcggccgctgccccgaggccacctgccag
gaccccgtaaggcctcaaggacagtgctgcgacctctgcggagctatcgtgtcgttgacc
cacgaccccacatttgacctggagcggtaccgagcgcggctgctggacctcttcctgaag
cagccccagtaccagggcctgcaggtggcggtgtccaaggtgctgcgcgacgcccacacc
gagatccaggtggtgctgctggagacccggccggcgaccggcgcagcggggcagctgggc
cacgcgctccttcaggacgcggtggcacaaggcagcgtgctcggcatcgtgtcggcgacc
ctgcggcagtcgggcaagcccacggcggcaaactcggcgctggatcagaacgggtccgga
gccgggctggcgggcggcgtggcggccgtggtgctgctggctctggtggggactgtgctg
ttgctgctacaccgcagcgggaggctcaggtggagaaggcacggagatgctgagcccaca
tcggctgggctgccgctgggtttccgaaatccgattttcgacgtgatggtcttcaagcag
cagcaggcctcggtagagtttgctgactcaactcagaaggtggacatcttggacattgat
accaacttcggctgcttcgttaacccactctttgctggggaggcagaggcagaggcctga

DBGET integrated database retrieval system