KEGG   Rattus norvegicus (rat): 314480Help
Entry
314480            CDS       T01003                                 

Gene name
Gpr132, G2a
Definition
(RefSeq) G protein-coupled receptor 132
  KO
K08426  G protein-coupled receptor 132
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    314480 (Gpr132)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Proton-sensing GPCRs
    314480 (Gpr132)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 314480
NCBI-ProteinID: NP_001164066
RGD: 1310817
Ensembl: ENSRNOG00000013914
UniProt: D3ZIH1
Position
6q32
AA seq 376 aa AA seqDB search
MRSEPTNATGNATAVTSTLQTTSVPTSCHTLSYEESRVVLVAVYSVVCMLGLPANCLTAW
LTLLQVLQRNVLAVYLFCLSLCELLYISTMPLWIIYIQNQHKWSLGQQACKVTAYIFFCN
IYTSILLLCCISCDRYMAVVYALESRGHRHQRTAVTISACVVILVGLVNYPVFDMKVEDS
FCFEPLGIDSRIAGYYYLRFTFGFAVPLGVLAFTNHQIFRSIKLSDSLSAAQKNKVKRSA
IAVVTIFLVCFAPYHVVLLIKAASFSFYEGDRDAVCDFENRLYTVSTVFLCLSTVNSVAD
PIIYVLATDHSRQEVCRIHTGWKKWSTKTDVTYLKDSEETHSPTALMNAYTFPSTVHLPG
SQPVELGSLGSAGETA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcagaacccaccaatgcaacaggaaatgccacggcggtcacctctactcttcag
actacctcggtccccacgagctgccacacgttgtcctacgaggagagcagagtggtcctg
gtggcggtgtacagcgtggtgtgcatgctgggcctaccggccaactgcctaactgcctgg
ctgacactgttgcaagtcctacagagaaacgtgctcgccgtctacctgttctgtctgtcc
ctctgtgagctgctgtacatcagcaccatgcctctgtggatcatttacatccagaatcag
cacaaatggagcctgggtcagcaggcctgcaaagtgacagcttacatcttcttctgcaac
atctacaccagcatcctcttgctctgctgcatttcctgcgaccgctacatggccgtggtc
tacgcactggagagccgaggtcaccggcaccagaggactgctgtcaccatttcggcatgt
gtggttattcttgttgggcttgtcaactatccagtgtttgacatgaaagtggaggacagc
ttctgctttgagcccctggggatcgacagtaggatagccggctactactacctgcggttc
acttttggctttgccgtccctctcggcgtccttgccttcaccaatcaccagatcttccgg
agcatcaagctcagtgatagcctgagcgctgcgcagaaaaacaaggtgaagcgctccgcc
attgcagtcgtcaccatcttcctggtctgctttgctccctaccacgtggtgctcctcatc
aaagccgccagcttttccttctacgaaggagaccgggatgcggtgtgtgacttcgaaaac
aggctgtacacggtctctacagtgttcctgtgcctgtcgacggtcaacagtgtggctgac
cccatcatctacgtgctggctacagaccattctcggcaagaagtgtgcaggatccacacg
gggtggaagaagtggtccacgaagacagatgtcacctacttgaaggactctgaggagacg
cactcacccacagcgcttatgaacgcatacaccttccccagtactgtgcaccttccaggc
tcacagccagtggagctagggtcactgggctctgccggagagactgcctga

DBGET integrated database retrieval system