KEGG   Rattus norvegicus (rat): 314548
Entry
314548            CDS       T01003                                 

Gene name
Osgepl1
Definition
(RefSeq) O-sialoglycoprotein endopeptidase-like 1
  KO
K01409  N6-L-threonylcarbamoyladenine synthase [EC:2.3.1.234]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    314548 (Osgepl1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.234  N6-L-threonylcarbamoyladenine synthase
     314548 (Osgepl1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    314548 (Osgepl1)
 Prokaryotic type
    314548 (Osgepl1)
SSDB
Motif
Pfam: TsaD BcrAD_BadFG NADH_4Fe-4S
Other DBs
NCBI-GeneID: 314548
NCBI-ProteinID: NP_001019958
RGD: 1305575
Ensembl: ENSRNOG00000004001
UniProt: Q4V7F3
Position
9q22
AA seq 414 aa
MLMLSKTAGAIPRPPRSNVRGFIRRFNVQPRALFHHKLVLGIETSCDDTAAAVVDETGNV
LGEALHSQTEVHLKTGGIVPPVAQQLHRENIQRIVEEALSASGVSPSDLSAIATTIKPGL
ALSLGVGLSFSVQLVNQFKKPFIPIHHMEAHALTIRLTHKVGFPFLVLLISGGHCLLALV
QSVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKEGNRFHFTIN
PPMQNAKNCDFSFTGLQHVTDKLITHKEKEEGIEKGQILSSAADIAAAVQHATACHLAKR
THRAILFCQQKNLLSPANAVLVVSGGVASNLYIRRALEIVANATQCTLLCPPPRLCTDNG
IMIAWNGIERLRAGLGILHDVEDIRYEPKCPLGIDISREVAEAAIKVPRLKMTL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgctaatgttaagtaagacagcaggagctattccgagaccaccaaggagtaacgttcgt
ggatttataagaagatttaatgttcaacctagagcactttttcatcataaactggtgctg
ggaattgaaaccagctgtgatgacacagcagctgctgtggtggatgaaactggaaatgtg
ctgggagaagcactgcactcccagacggaagtccatctgaaaacaggtgggattgttcct
ccagtcgctcaacagcttcacagagaaaatattcagcgaatagtagaagaagctctttct
gccagtggggtctccccaagcgacctctcagcaattgcaactaccatcaaaccaggactg
gccctaagcctgggggttggcttatcctttagcgtacagctagtaaatcagtttaaaaag
ccatttatcccaatccatcacatggaggctcacgcgctgactattaggctgacccacaaa
gtcggatttccttttttagttcttttgatttctggaggccactgcctgttggcgttagtt
cagagtgtttcagattttctgctcctcgggaagtccctggacatagcgccaggcgacatg
cttgacaaggtggcaagaagactttctttaatcaaacatccagaatgttctacaatgagt
ggtgggaaagctatagaacatttggccaaagaaggaaatagattccactttactatcaat
ccacccatgcagaatgctaagaactgtgatttttcttttacgggacttcaacatgtcacc
gataagctaataacacacaaggaaaaagaagaaggcattgagaaggggcaaatcctgtca
tcagccgcagacattgctgctgcggtacagcacgcaacagcgtgccaccttgcgaaaaga
acacatcgtgctattctgttttgccagcagaaaaatttgctatctccagctaacgcagta
ttagttgtgtctggaggtgttgcaagtaacttgtacatccgaagagcattggaaattgta
gcaaatgcaacacaatgcactttgttgtgtccccctccgagactgtgcactgacaatggt
atcatgattgcatggaatggaattgaaagattacgtgctggcttgggcattttacatgat
gtagaagacatccgatacgaaccaaaatgtcctctcggaatagacatatccagagaagtt
gcagaagctgccataaaagtaccacgattaaaaatgacactttga

DBGET integrated database retrieval system