KEGG   Rattus norvegicus (rat): 314612
Entry
314612            CDS       T01003                                 

Gene name
Shc2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05034  Alcoholism
rno05100  Bacterial invasion of epithelial cells
rno05214  Glioma
rno05220  Chronic myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    314612 (Shc2)
   04014 Ras signaling pathway
    314612 (Shc2)
   04370 VEGF signaling pathway
    314612 (Shc2)
   04072 Phospholipase D signaling pathway
    314612 (Shc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    314612 (Shc2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    314612 (Shc2)
   04062 Chemokine signaling pathway
    314612 (Shc2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    314612 (Shc2)
   04915 Estrogen signaling pathway
    314612 (Shc2)
   04917 Prolactin signaling pathway
    314612 (Shc2)
   04926 Relaxin signaling pathway
    314612 (Shc2)
   04935 Growth hormone synthesis, secretion and action
    314612 (Shc2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    314612 (Shc2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    314612 (Shc2)
   05226 Gastric cancer
    314612 (Shc2)
   05214 Glioma
    314612 (Shc2)
   05220 Chronic myeloid leukemia
    314612 (Shc2)
   05224 Breast cancer
    314612 (Shc2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    314612 (Shc2)
  09165 Substance dependence
   05034 Alcoholism
    314612 (Shc2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    314612 (Shc2)
   01522 Endocrine resistance
    314612 (Shc2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 314612
NCBI-ProteinID: NP_001101535
RGD: 1307137
Ensembl: ENSRNOG00000008030
UniProt: O70142
Position
7
AA seq 573 aa
MTQGPGGRAAPEPEAPTTFCALLPRMPQWKFAAPGSFLGRGPAAARVAGAAEAQPEPGVP
ALAAVLGACEPRCAAPCPLPALGRCRGSGSRGARGTPDVADEWVRKGGFIHKPAHGWLHP
DARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAP
NKALASILGKSNLRFAGMSISVNISVDGLNLSVPATRQIIANHHMQSISFASGGDTDMTD
YVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKAVVPPERLTGL
EESAWGDGEVTADHDYYNSIPGKEPPLGGLVDSRLAVTQPCALTTLGGLGQGLSPAWRDV
RGLPWDMGPSGAVPPGDGYVQADARGPHDYEEHLYVNTQGLDALELEDTSETPLQPEDSP
KKDLFDMRPFEDALKLHECSVAAGITAASLPLEDQWPSPPTRRAPIAPTEEQLRQEPWYH
GRMSRRAAEKLLRADGDFLVRDSITNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFE
SISHLIDYHLKNGLPIVAAESELHLRGVVSREP
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgacgcagggtcccggtggccgcgcggcccccgagcccgaggcgcccaccaccttctgc
gcgctgctaccgcgcatgccgcagtggaagttcgcggcgcccggtagcttcctgggccgc
ggtccggcggctgcgcgcgtggcgggggcggcagaggcgcagcccgagcctggggtcccc
gcgctggccgccgtgctgggtgcctgcgaaccgcgctgtgccgcgccctgtccgctacca
gctctcggccgctgccggggctcggggtcgcggggcgcgcggggaactcccgacgtcgcc
gacgagtgggtgcgcaagggcggcttcattcacaagcccgcgcacggctggctgcacccc
gatgcgagggtcctggggcccggggtctcttacatcgttcggtacatgggctgcattgag
gtgctccgatctatgcgctccctggatttcaacacccggacacaggtgacgagggaagcc
atcaatcggctccacgaggctgtgccaggtgtccgaggctcctggaagaagaaggccccc
aacaaggcgctggcctccatcttggggaaaagcaacctgcgcttcgccggcatgagcatc
tcagtcaacatctctgtggacggccttaacttgtcagttcccgctacccgtcagatcatc
gccaaccatcacatgcagtctatttccttcgcctccggtggcgacacggacatgaccgat
tacgtggcctatgtggccaaggaccccatcaaccagagagcctgccacatcttggaatgc
tgtgagggtctcgcccagagtgtcatcagcaccgtggggcaagcctttgagctgcgcttc
aagcaatacctgcacagtccgcccaaggctgtcgtgccccctgaaaggctgaccgggctg
gaggagtcggcctggggtgatggtgaggttactgcagaccacgattactacaacagcatt
ccaggaaaggagccacccctgggcgggctggtggactccagactggctgtcacacagccc
tgtgcgctgacaacacttgggggccttggacagggattgtcacctgcctggagagatgtc
cgtggcttgccttgggacatgggcccctctggagcagtcccacctggggatggctacgtg
caggcagatgcccgagggccacatgactacgaggaacacctgtatgtcaacacccagggc
ctggacgctttggagcttgaggacacctccgagacacctctgcagcctgaggacagcccc
aagaaggacctgtttgacatgcgaccctttgaagatgccctgaagttgcacgagtgctcc
gtggcagcaggcattactgcagcctcactccctctggaggatcagtggcccagcccccct
acccgcagggcccccattgcacccacagaggagcaactgaggcaggagccctggtaccat
ggacgaatgagccgtcgggctgcagagaagctgcttcgtgccgatggggacttccttgtg
agagacagcatcaccaacccggggcagtatgtcctcacaggcatgcacgcggggcagccc
aagcacctgctgctggtggaccccgagggtgtggtacggacaaaagatgtgctgtttgag
agcatcagccacctcatagactatcacctgaagaacgggttgcccatcgtggctgccgag
agtgaactgcatctgcggggagtggtctctcgggagccatga

DBGET integrated database retrieval system