KEGG   Rattus norvegicus (rat): 314615Help
Entry
314615            CDS       T01003                                 

Gene name
Prtn3
Definition
(RefSeq) proteinase 3
  KO
K01350  myeloblastin [EC:3.4.21.76]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    314615 (Prtn3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.76  myeloblastin
     314615 (Prtn3)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   314615 (Prtn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 314615
NCBI-ProteinID: NP_001019435
RGD: 1304898
Ensembl: ENSRNOG00000029814
UniProt: Q8K597
Position
7q11
AA seq 254 aa AA seqDB search
MAGIRPSLKGMHPFLLLALVFGGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGG
TLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTITQVFENNYNPEETLND
VLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVV
TFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSM
YVNWIHSVLRSAEP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctggaatccgcccatccctcaaagggatgcatcccttcctgctgcttgccctggtc
tttggtggtgcagtccaggcctccaagatagtgggtgggcacgaggctcggccccattct
cggccttatgtggcatccctgcagctgagcaggtcccctgggagccacttctgtggtggc
acgctgatccacccgagattcgtgctgacagctgcccactgcctgcaggacatctcctgg
cagcttgtgacagtggtgctgggtgcccacgacctgctgagctcggagcctgagcagcag
aagttcactatcactcaggtcttcgagaacaattacaaccccgaggagaccctcaatgat
gtgcttctccttcagctaaaccggccggcctccctgggcaagcaggtggcggtggcctct
ctgccccagcaggaccagtctctctcccagggcacccaatgcctggctatgggctggggc
cgcctgggcacccgagcgcccacgccccgtgtgctgcatgaactgaacgtcacggtggtc
accttcctgtgccgagaacacaacgtgtgcacgctggtgccacggagggcagcaggcatt
tgcttcggagactcgggcggccccttgatctgcaacggcattcttcatggagtggactcc
ttcgtgattcgcgaatgcgcctccctccagtttcccgatttcttcgcccgggtgtccatg
tatgtgaactggattcacagtgtgctgcggagcgcagagccctga

DBGET integrated database retrieval system