KEGG   Rattus norvegicus (rat): 314616
Entry
314616            CDS       T01003                                 

Gene name
Arid3a
Definition
(RefSeq) AT-rich interaction domain 3A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: ARID
Other DBs
NCBI-GeneID: 314616
NCBI-ProteinID: NP_001101536
RGD: 1305299
Ensembl: ENSRNOG00000026435
UniProt: B5DEX9
Position
7q11
AA seq 594 aa
MKLQAVMETLIQRQQRARQELEARQPPLPPPPEPAGVQARTTMTDEDREPENARMHRTQM
AALAAMRAAAAGLRHPSSPGGSEDEDTAQGGTLSSPALHGSGQEGPGHTEGDGHLMDMGS
DDDTKPKWEEQELEELGEEEEEEDEDDFEEEEEDEEEEGLGLPESASLGSAGLFTRKAPP
TQTFRGDGGPRMLSGPERLGPGPAHPSHVASQMPPPDHGDWTFEEQFKQLYELDADPKRK
EFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLN
LPTSITSAAFTLRTQYMKYLYPYECERRGLSSPNELQAAIDSNRREGRRQSFGGSLFAYS
PSGAHSMLSSPKLPVTSLGLAASTNGSSITPTPKIKKEEDSAIPITVPGRLPVSLAGHPV
VAAQAAAVQAAAAQAAVAAQAAALEQLREKLESTEPPEKKMALVADEQQRLMQRAVQQSF
LAMTAQLPMNIRINSQASESRQDPAVNLTSANGSNSISMSVEMNGIVYTGVLFAQPPPPT
PPPASSKGGVSSIGTNNTMGNRTGASGSAGSSGQVGLAGVSAPTMSSTSNNSLP
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgaagctgcaggcagtgatggagactcttattcagaggcaacagcgagcccggcaggaa
ctggaggctcgacagcctccactacccccaccaccggagcccgctggtgtccaggctcgg
accaccatgacagatgaggacagggagcctgagaatgcccgtatgcataggacgcagatg
gctgcactggctgccatgcgggctgctgccgccggcttgagacatccgtcctctcccggg
ggctcggaggacgaagacacagcccagggagggactctgagttcacctgccctgcatgga
agtggccaggagggaccgggacacactgagggagacggccatttgatggacatgggctcc
gatgatgacacgaagcccaagtgggaagaacaagagctggaagaactgggggaagaggaa
gaggaggaggatgaagatgactttgaggaagaagaggaggatgaggaggaagaaggcctg
ggcctcccagagtctgccagcctgggctccgcaggcctgtttacccgcaaggccccacct
actcagaccttccgtggagacggtggtcccagaatgctcagtggccctgagcgcctggga
cctggcccggcccaccccagtcatgtggcgtcccagatgccaccaccggaccatggggac
tggacatttgaggagcagttcaaacagctctatgaactggacgcagaccccaagaggaaa
gagttcctggacgacctgttcagcttcatgcagaagcggggcactccggtgaaccggatc
cccatcatggccaagcaggtcctcgacctgttcatgctgtatgtgctggtgacggaaaag
ggcggtctggtagaggttatcaacaagaagctgtggagggagatcaccaaggggctcaac
ctgcccacctccatcaccagtgctgccttcacacttcggacacagtacatgaagtatctt
tacccctatgagtgtgagaggcgaggcctgagcagccccaatgagctccaggctgccata
gacagcaaccgccgggagggcaggcgccagagcttcgggggctccctctttgcttactca
cccagtggagcccacagcatgctgtcctcacccaagctaccggtgacttctttgggcctt
gctgccagcaccaatggcagctctatcaccccaacacccaagatcaagaaagaggaagac
tcagccatccccatcacagtcccaggccgcctacccgtgtctctggcaggccaccctgtc
gtagcagcccaggcagcggctgtgcaagccgcagcagcccaggctgcagttgcggcccag
gcagccgccctggaacaactccgggagaagctggaatccacggagcctccggaaaagaag
atggccctggttgcagatgagcagcagcgtctcatgcagcgagccgtgcagcagagcttc
ctggccatgacagcccagctgcccatgaacatccggatcaacagccaagcctctgagagt
cgccaggacccagctgtaaatctcaccagtgccaatggcagcaacagtattagcatgtcc
gtggagatgaacggtattgtatacacaggggtgctgttcgctcagccaccacctcctacg
ccacctcccgcctccagcaaaggtggtgtgagcagcattggtaccaacaacaccatgggt
aaccggacaggagccagtggcagtgctggcagcagcggccaagtggggctggctggggtg
tctgcacccaccatgtcttctacctcaaataactccttgccttaa

DBGET integrated database retrieval system