KEGG   Rattus norvegicus (rat): 314681Help
Entry
314681            CDS       T01003                                 

Gene name
Ric8b
Definition
(RefSeq) RIC8 guanine nucleotide exchange factor B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Ric8 WAPL PUL Rif1_N
Motif
Other DBs
NCBI-GeneID: 314681
NCBI-ProteinID: NP_783188
RGD: 631419
Ensembl: ENSRNOG00000007323
UniProt: Q80ZG0
Position
7q13
AA seq 520 aa AA seqDB search
MDEERALYIVRAGEAGAIERVLRDYSDKHRATFKFESADEDKRKKLCEGIFKVLVKGVPT
TCQVPCLEVLRILSRDKKILAPVTTEENMQILLRLAKLHESDDSLEKVSEFPVIVESLKC
LCNIVFNSQVAQQLSLELNLAAKLCNLLRKCKDRKFINDIKCFDLRLLFVLSLLHTDIRS
QLRYELQGLPLLTQILESAFSIKWTDEYESAIDHSGPPLSPQETDCAIEALKALFNVTVD
SWKVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL
THEETAQEAATLDELPGDKTAEKDTALKSSAMVYNGMNMEAIHVLLSFMEKRIDKGSSYR
EGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGV
KQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKN
AKPKEELLKPMGLKPDGTITPLEEALSQYSVIEETSSDTD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagagcgcgccctctacatcgtccgggccggcgaggcgggggctatcgagcgg
gtcctgagagattacagcgacaagcatagggctactttcaaatttgaatcagcagatgaa
gataaaagaaagaaactctgtgaaggcatatttaaggtcctggtaaagggtgtcccaaca
acatgccaagtgccctgcctggaagttctccgcattctctccagagacaaaaagatttta
gctcctgtaacaactgaggaaaatatgcaaatactgctgagactggccaagctccatgag
tcggacgattctttggagaaggtgtcagagttcccggtcattgtggagtcattgaaatgt
ctttgtaacatcgtgttcaacagtcaggtggcacagcagcttagcctggaactgaatctc
gctgcaaagctctgtaacctcctgaggaagtgcaaggaccggaaatttatcaatgacata
aagtgctttgacctgcgcttgctctttgtcctgtcacttttgcacactgacatcaggtca
caattgcgctatgagctccagggactgccgctgctaacccagatcttggaaagtgccttt
agcatcaagtggaccgatgagtatgagtcggccatagaccatagtggacctcctctctca
cctcaggagacagactgtgccattgaggccctcaaagctctgttcaatgtgacggtagac
agttggaaggtgcataaagagagcgattctcatcagttccgtgtcatggccgctgtcctt
cgccactgtttactaattgtaggtccaaccgaagacaaaacggaagagctgcacagtaat
gccgtcaaccttttaagcaatgttccagtctcttgtttggatgttctcatttgtccatta
acccatgaagaaacagcccaggaggcagcaactctagacgaactgcccggtgataagaca
gcagagaaagacacggctttgaagagcagtgccatggtatacaatggcatgaacatggag
gccatccacgttttactcagttttatggagaagaggattgataagggaagcagctataga
gagggtctaactccagttctcagcttattaacagaatgttcccgagcccatcggaacatc
cgaaaatttctcaaagatcaggtgttaccacctttgagggatgtgacaaatcgaccagaa
gtcggctcaaccgtgagaaataagctggtgcgcctcatgacacacgttgacctcggagtc
aagcagattgctgctgagttcctcttcgtcctttgcaaagagcgagtggatagtctgctg
aagtacactggctatgggaacgctgcaggactgctggctgccaggggcctcttggctgga
ggaagaggagacaattggtactcagaggacgaggacacggacactgaggaatacaaaaac
gcaaaaccaaaagaggagttgcttaaaccaatgggactaaaacctgacgggacaataacg
cctttggaggaagcgctcagccagtattctgtcatcgaagagaccagctcggacacagac
tga

DBGET integrated database retrieval system