KEGG   Rattus norvegicus (rat): 314690
Entry
314690            CDS       T01003                                 

Gene name
Washc4
Definition
(RefSeq) WASH complex subunit 4 isoform X2
  KO
K18465  WASH complex subunit 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    314690 (Washc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314690 (Washc4)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   WASH complex
    314690 (Washc4)
SSDB
Motif
Pfam: WASH-7_N WASH-7_mid WASH-7_C
Other DBs
NCBI-GeneID: 314690
NCBI-ProteinID: XP_006241267
RGD: 1309995
Ensembl: ENSRNOG00000008331
Position
7
AA seq 1172 aa
MAVDTLSPDWDFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDLVGDVWDFN
LDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKHEAETKFYNGLLFYG
EGAADSSMAEGDCQIQMGRFVSFLQELSCFVTRCYEVVMSVIHQLAALYISNKTGPKIIE
TTGVHFQTMYEHLGELLTVLLTLDEIIDNHVTLKDHWTMYKRLLKSVHHNPSKFGIQEER
LKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGISVSKNSTFAEEFAHSIRSIFANVE
AKLGEPSEIDQRDKYVGICGLFVLHFQIFRTVDKKFYKSLLDICKKVPAVTLTANIIWFP
DNFLIHKMPAAAKLLDRKSLQAIKIHRDAFLQQKAQSLTKDVQSYYVFVSSWMMKMESML
SKEQRTDTFAEDLTNTCNVFIQGFLYAYSISTIIKTTMNLYMSMQKPMTRTSVKALCRLI
ELLKAVEHMFHRRSMVVADSVSHITQHLQHQALNSISVAKKRVISDKKYSEQRLDVLSAL
VLAENTLNGPSTKQRRLVVSLALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQTQ
CDCCFLYWHRAVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHSRHLESHELLLDCY
DKEIMDILNERLLDKLCKETEKDLRLSVHTHLKLDDRNPFKVGRKDLALFFSLNPIRFFN
RFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMTEAHLPSQTLEQGL
DVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVN
FTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLG
ITPEGQSYLDQFRQLLSQIGNAMGYIRMIRSGGLHCSSNAIRFVPDLEDIVSFEELVKEE
GLAEETLRAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPL
TLNFVEHSISCKEKLNKKNKIGAAFTDDGFAMGVAYTLKLLDQYQEFDSLHWFQSVREKY
IKEIRAVAKQQSVQSTSQDEKLLQTMNLTQKRLEVYLQEFELLYFSLSSARIFFRADKTA
AEENQEKKEKEETKMSNGDGSESTVSADPVVK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atggccgtggacactctgtcacccgactgggacttcgaccgcgtggacgacggctctcag
aaaattcatgctgaagtgcagcttaagaactatgggaaatttctggaggagtatacatct
cagctgagaagaattgaggacgccctggatgatttggttggagatgtttgggatttcaat
cttgatcctatagcattaaagcttcttccatatgagcagtcttcccttttagaactcata
aagactgaaaacaaggtcctcaacaaagtcatcactgtttatgctgcactctgttgtgag
atcaagaaattaaaacatgaggctgaaactaagttttacaatggtctcctgttttatggt
gaaggagctgcagattccagcatggcggaaggtgactgccaaatccaaatggggaggttc
gtttccttcttacaggaactgtcctgcttcgtgacgaggtgctacgaggtggtgatgagt
gtcatccatcagctggccgccctgtacatcagcaacaagacaggacccaaaattatagag
acaactggagttcactttcagactatgtatgaacacttgggagaactgctaacagtttta
cttaccctggatgaaattattgacaatcatgtcactctgaaggaccactggactatgtac
aaaaggttgctgaaatctgtccatcacaacccttcaaaatttgggattcaggaagaaaga
ttaaagccttttgagaagttcttgctgaagctggaagggcagttgcttgatggaatgata
ttccaggcttgtattgaacaacagtttgattctctcaacggagggatatctgtgtcgaaa
aatagcacttttgcagaagagttcgcacatagcattcgctcaatttttgccaacgtggaa
gccaagctcggcgaaccttctgaaattgaccagagagacaagtatgttggcatttgtggg
ctctttgtactgcactttcagatttttcgaactgttgataaaaagttttataagtcttta
ttggacatttgtaagaaggtgccagccgtcactttaactgctaatattatttggtttcct
gataattttctgattcataaaatgccagcagctgccaaactcctagacagaaaaagtctt
caagccattaaaatacacagggatgccttcctacagcagaaagctcagtcgctcaccaaa
gatgtgcagtcttactacgtctttgtgagctcgtggatgatgaagatggagtctatgtta
tctaaagagcagaggacggatacatttgccgaagacctcaccaacacatgtaatgttttc
atacagggcttcttatatgcatatagtattagcaccattataaagaccacgatgaacctc
tacatgtccatgcagaagcctatgaccagaacctccgtgaaggcgctgtgcaggctcatt
gagcttctcaaggcggtagagcatatgttccacaggagaagcatggttgttgcggactcg
gtgtcacatataacacagcaccttcagcatcaggctcttaactctatctctgtagccaag
aaaagagtaatttcagacaagaaatacagtgaacagcgtcttgatgtgctgtctgctctt
gttttggctgagaacaccttaaatggaccaagcaccaaacaacgacgacttgttgtttct
ttggcgttgagtgttggcacgcaaatgaaaacattcaaagatgaagaactctttcccctg
caagttgtcatgaaaaaactcgatcttatcagtgaactgagggaacgagtccaaacacag
tgtgactgttgttttttatactggcatcgcgctgtcttcccgatttatttagatgatgtc
tatgagaatgctgttgatgcagctagattacattacatgttcagtgctttacgagactgt
gtacctgccatgatgcattcaaggcacttagagtcccatgagctgcttctggattgctat
gacaaggaaatcatggacattttaaatgagcgtctgctggataagctgtgtaaggagacg
gagaaggacttgcggctctccgtgcacactcacttgaagctggatgaccggaaccccttc
aaagtgggcagaaaggacttggctctgtttttctctctgaacccgattcggtttttcaac
cgcttcattgacattcgagcttatgtgactcactatctagataagactttctacaatctc
acaacagtagctcttcatgattgggccacttacagtgaaatgcgaaatttggctacgcag
cgttatgggttggttatgacagaggcacatcttcctagccagactctggagcagggactc
gacgttctggaaatcatgagaaacattcacatatttgtctctcgatacctctataatctc
aataatcagatttttattgaacggacaagcaacaataaacatttgaatactattaatatt
cgacatattgctaattcaattcgaacacatgggacagggatcatgaatacaacagttaat
tttacctaccagtttttgaaaaagaagttctatatatttagccagtttatgtatgatgaa
catatcaaatccagattgattaaagacattcggtttttcagggagatcaaggaccaaaat
gatcacaagtatccttttgatagggcagaaaagttcaatcgcggcataagaaaacttgga
atcactccagagggacagagctacctcgaccagttcaggcagctcctcagtcagatcggt
aatgctatgggctatatacgaatgataagatctggtggtcttcattgtagcagcaatgcc
attagattcgtgccggatcttgaagacattgtgagtttcgaagagctcgtgaaggaagaa
gggcttgcagaagaaacacttagagcagccaggcatttggactcggtcctcagtgatcat
acacgaaattctgccgaaggcacagaatacttcaaaatgcttgtagatgtttttgctcca
gaatttcgaaggccaaagaatatacatctccgaaatttctatatcattgtccctcctctc
actctgaactttgtagaacattctataagttgcaaagagaaattgaataaaaaaaacaaa
ataggagctgcgtttactgacgatggttttgccatgggtgtggcttataccttgaagctt
ttggaccagtaccaggagtttgattcacttcactggttccagtctgttagagaaaaatac
ataaaggagataagagcggttgctaagcaacagagcgtgcagtcaaccagtcaagatgaa
aagctgctgcaaaccatgaaccttactcagaagcggctggaggtctatctacaggaattt
gaactgctgtatttctccttgagcagtgcaagaattttcttcagagcagacaagactgcg
gctgaagagaaccaagaaaagaaagagaaggaagaaactaaaatgagcaatggagacgga
tccgagagcactgtgtctgcggatcctgtcgtgaagtga

DBGET integrated database retrieval system