KEGG   Rattus norvegicus (rat): 314694
Entry
314694            CDS       T01003                                 

Gene name
Chst11, C4ST1
Definition
(RefSeq) carbohydrate sulfotransferase 11
  KO
K01017  chondroitin 4-sulfotransferase 11 [EC:2.8.2.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    314694 (Chst11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    314694 (Chst11)
Enzymes [BR:rno01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.5  chondroitin 4-sulfotransferase
     314694 (Chst11)
Glycosyltransferases [BR:rno01003]
 Unclassified
  Sulfotransferases
   314694 (Chst11)
SSDB
Motif
Pfam: Sulfotransfer_2
Other DBs
NCBI-GeneID: 314694
NCBI-ProteinID: NP_001101549
RGD: 1308400
Ensembl: ENSRNOG00000008885
UniProt: P69478
Position
7q13
AA seq 352 aa
MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPL
QELYNPIQLELSNTAILHQMRRDQVTDTCRANSAMSRKRRVLTPNDLKHLVVDEDHELIY
CYVPKVACTNWKRLMMVLSGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYM
KFLFVREPFERLVSAYRNKFTQKYNTSFHKRYGTKIIRRQRKNATQEALRKGDDVKFEEF
VAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLRLAGVSGYLK
FPTYAKSTRTTDEMTTEFFQNISAEHQTQLYEVYKLDFLMFNYSVPNYLKLD
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaagccggcgctgctggaagtgatgaggatgaacagaatttgccggatggtgctggcc
acttgcttgggatcctttatcttggtcatcttctatttccaaagtatgttgcacccagtc
atgcggaggaatccctttggcgtggacatctgctgccggaaggggtctcggagtccactg
caggagctctacaatcccatccagctggagctctccaacactgccatcctgcaccagatg
agacgggaccaggtgacagacacctgccgggccaacagcgccatgagccgcaagcgcagg
gtgctgacccccaacgacctgaagcacctggtggtggatgaggaccacgaactcatctac
tgctatgtacccaaggtggcgtgcaccaactggaagaggctcatgatggtcctgagcggc
cggggcaagtacagcgaccccatggagatcccagccaacgaggcccacgtgtcggccaac
ctgaagacccttaaccagtacagcatcccagagatcaaccaccgcttgaaaagctacatg
aagttcctgttcgtgcgggagcccttcgagaggctggtgtctgcctaccgcaacaagttc
acgcagaagtacaacacctccttccacaagcgctacggcacgaagatcatccggcgccag
cggaagaacgccacgcaggaggccctgcgcaagggggacgatgtcaagttcgaggagttc
gtggcctacctcatcgacccccacacccagcgcgaggagcccttcaacgagcactggcag
acggtctactccctctgccacccatgccacatccactacgacctcgtgggcaagtacgag
acgctggaggaggactccaattacgtactgcggctggccggggtgagcggctacctgaag
ttccccacctatgcaaagtccacccgaactaccgacgagatgaccacggagttcttccag
aacatcagcgccgagcaccagacacagctgtacgaagtctacaaactggactttttaatg
ttcaactactcagtgccaaactacctgaagttggattag

DBGET integrated database retrieval system