KEGG   Rattus norvegicus (rat): 314764
Entry
314764            CDS       T01003                                 

Gene name
Eea1
Definition
(RefSeq) early endosome antigen 1 isoform X1
  KO
K12478  early endosome antigen 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    314764 (Eea1)
   04145 Phagosome
    314764 (Eea1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    314764 (Eea1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314764 (Eea1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    314764 (Eea1)
 Protein recycling
   Other Rab GTPase associated proteins
    314764 (Eea1)
SSDB
Motif
Pfam: FYVE ATG14
Other DBs
NCBI-GeneID: 314764
NCBI-ProteinID: XP_038936032
RGD: 1310167
Ensembl: ENSRNOG00000021681
Position
7
AA seq 1558 aa
MDRPRRRGCSDSAPRPRRAGPPSCQLRGRPGRRALAGYLLAGSCSQPLAACGEVGAAKAA
STAASSPPSSRLGCRPSRPPVVSNPHWVRRVPAAAAAAAAAAGQTMFRRILQRTPGRVGS
QGSDLDSSATPINTVDVNNESSSEGFICPLCMKRCVTAIDLSEHYQQVHTELETRGQELL
SDSNVTGFICPQCMKSLGSADELFKHYQAVHDAGNDSGHGGEASLALTRDDIALLRQEVQ
DLQASLKEEKWYSEELKKELEKYQGLQQQEAKSDGLVTDSSAELQSLEQQLEEAQTENFN
IKQMKDLFEQKAAQLATEIADIKSKYDEEKGLRAAAEQKATHLTEELSKQTTVIQDLKTE
LLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSEHANSEATINQLR
SELAKGPQEVAVYVQEIQKLKGSVNELTQKSQTLMEKLQKKDLDYTHLEEKHNEEALSRK
NTQAALHQRDLDCQQLQARLTASEGSLQRIQGELREKGEAAQKLKEELREVETKHQHLKV
EFKQLQQQREEKEQHGLQLQGEVSQLHSKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQ
QVADLQLKLSRLEEQLKEKVTNSTELQHQLEKSKQQHQEQQALQQSTTAKLREAQNDLEQ
VLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGETAVLNQLQEKNHAL
QQQLTQLMEKLKNQSESHKQAEENLHDQVQEQKAHLRAAQDRVLSLETSVSELSSQLNES
KEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKVSAQLDQV
TAKFQEKQEHCTQLESHLKDYKEKHLSLEQKAEDLEGQIKKLEANNLEVKASREQAVQSL
QQQRQLSTDLELRNAELRKQLQEQKEVVSHTKLDLQNKSEALENIKQTLTKKEEEKVVLK
QEFEKLSQDSEAQHKELSDRMQAAITELMVMTAQKDALLAELSTTKGKLSKVSDSLQTSR
SEFEKESQKGKAAVLDLEKACKELKHQLQQQTESALKEQSELKKSLEKERETSQQLMIEL
NSVKGEVTQAQNTLKQKEKEEQQLQGNINQLKQATEQKKKQMEALQGELKNVTSQKAQLE
SKLQQQAAQAAQELAVEKGKLSALQSTYDKCQADLQQLQSDLYGKESELLATRQDLKCVE
EKLALAQEDLISNRNQIGNQNKSIQELQAAKAALEQDLAKKEEVLKEQSKALQDAQREKS
VKEKELVTEKSKLAEMEEIKCRQEKEIAKLKEELKSHKQESIKEVTNLKDAKQLLIQQKL
ELQGKVDSLKAALEQEKERQQLMREQMRKEEEKRKEEFSEKEAKLHSEIKEKEAGVKKHE
ENEAKLTMQVTTLNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERR
ALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDN
EVQNCMSCGKCFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4677 nt   +upstreamnt  +downstreamnt
atggacaggccgaggaggcggggctgcagcgactccgcccctcggccacggcgggcgggc
ccgcccagctgtcagttacgggggcggcccggcaggcgggcgctcgctggctacctcctc
gctggctcgtgctcgcagcctctcgccgcctgtggggaagtcggggccgccaaagccgcg
tccaccgccgcctcttccccgccctcctcccggctcggctgccggccctcgcgccctcca
gtcgtgagtaacccgcattgggtgcggagagtccccgcggcggcggcggcggcggcggcg
gcggctggacaaaccatgtttcggaggatcttgcagaggactcctgggagagttggctct
caaggttctgatttagattcatcagcaactcctataaatacggtggatgtcaataatgaa
agttcttcagagggtttcatctgcccattgtgtatgaaaagatgtgtaactgctattgac
ttgtcggaacattaccagcaagtacacactgaactcgagacgagaggacaggaacttctt
agtgactccaatgtgactggttttatatgtccccagtgtatgaaatctcttggctcagct
gatgaacttttcaaacactatcaggcagttcatgatgccggtaatgactcggggcatggt
ggagaggccagtcttgctttgacacgagatgacatagcactactcaggcaagaggtccaa
gacctgcaggcctcacttaaggaagaaaaatggtactcagaagaattaaagaaagaatta
gaaaaatatcaagggctacagcagcaagaggctaaatctgatggattggtgactgattca
tcagcagagctacagtctttagagcaacaattagaagaagcccaaactgagaattttaat
attaagcaaatgaaagatctgtttgaacagaaagcagctcaacttgctactgaaattgca
gatataaagtcaaaatatgatgaagaaaagggtctccgagcagctgcggaacaaaaagcg
acacatttgacagaagaattaagtaaacagacgactgtaattcaagacctgaaaactgag
ctgcttcagagacctggtatagaagatgtcgctgtactaaagaaagaactggtccaagtt
caaactctaatggataacatgactttggagcgtgagagagaatctgaaaaactcaaggat
gaatgtaaaaagttacagtcagaacacgctaactcggaggctaccataaaccagctaagg
agtgaacttgccaaaggcccccaagaagttgcagtatatgtgcaggaaatacaaaaactt
aaaggttcagttaatgaattaacacaaaaaagccagaccttgatggagaaattgcagaag
aaagacctggattacacccacttagaggagaagcataacgaagaggcactgagtagaaag
aatacccaggcagccctccaccaaagggacctggattgccagcagcttcaggcaaggcta
actgcatccgaaggctcgctacagaggatccaaggagagctcagggaaaagggagaggct
gctcagaagctcaaagaagaactgcgggaagtagagaccaagcaccagcatcttaaagtg
gagttcaagcagctgcagcagcagcgggaagagaaggagcagcatgggctgcagctgcaa
ggggaagtcagtcagttacatagcaaacttctggagactgagcgccaactaggggaagct
cacggtaggctgaaggagcagaggcaactttcaagtgagaagctgatggataaggaacag
caagtggctgacttacagctcaagctctctcgtctggaagagcagttgaaggaaaaggta
acaaattccactgaattgcaacatcaattagaaaaatcaaagcaacagcaccaagaacag
caagcccttcagcaaagcactacagccaaactccgagaagctcagaatgatttagaacaa
gtgttacgtcagattggagataaggaccaaaagatccagaaccttgaagccttactacag
aagagtaaagaaaatatttccttactagaaaaggaaagagaagacctttatgcaaaaatc
caagccggtgaaggagagactgctgtccttaaccagttgcaagagaaaaaccatgcacta
cagcagcaactaactcaactgatggagaagctgaagaatcagtcggaaagccataaacaa
gctgaggagaacttgcatgaccaggtacaggagcagaaggcacatcttcgagctgcacaa
gaccgtgttctttctctagaaaccagtgtcagtgaactaagcagtcagttaaatgaaagc
aaggagaaggtttcccagcttgacatacagattaaagccaaaactgaattattgctatca
gcagaagcagcaaaaactgctcaaagagctgatcttcaaaatcatttggacacagctcaa
aatgcactacaagataaacaacaggagttaaataaggtcagtgcacagctggatcaggtc
actgcaaagtttcaggagaagcaggagcattgcactcagctggaaagccatctcaaggat
tacaaggagaagcacctctctctagaacaaaaagcggaagacttagaaggccagattaag
aaactagaagccaataatcttgaagttaaagcaagcagggagcaagctgtgcagagccta
cagcagcagaggcagctgagcacagacctagagctcaggaatgcagagctcaggaagcag
cttcaagagcagaaggaagtagtatctcatacaaaattggatctacagaataaatctgaa
gcccttgaaaatattaaacaaaccctcactaagaaagaagaagaaaaagttgtcttgaaa
caggaatttgaaaagttaagtcaagattcagaggcgcagcacaaggagctgagtgacagg
atgcaagctgcgatcacagagctgatggtgatgacagcacagaaggacgctctcctggct
gagctctccacaacaaaagggaaactgtcaaaagtttcagattctttacaaacctccagg
agcgaatttgagaaagagagtcagaaaggaaaggctgctgtactagacttggaaaaagct
tgtaaagaattaaagcatcagcttcaacaacaaacagaaagtgcactgaaggagcagagt
gaactgaaaaagtcactggagaaggagagagagacttctcaacagttgatgatagaactc
aattcagtcaagggagaagtcacacaggctcaaaatacattaaagcagaaggagaaagaa
gagcagcagcttcaggggaacataaatcagctgaagcaagcaactgagcaaaagaaaaag
caaatggaagctcttcaaggagagcttaaaaacgttacttcacaaaaggcccagctggag
agtaaactgcagcagcaggcggcacaggcagcccaggaacttgctgtggagaaaggaaag
ctgtcagcactgcagagcacctatgacaagtgccaggccgacctgcaacagctgcagtct
gacctctatggcaaagagtctgaacttctagccacaaggcaagaccttaagtgtgtagaa
gagaagcttgctctggcacaagaagacctgatttcaaacagaaatcaaattggaaaccaa
aataaatcaattcaagaactgcaggctgccaaagctgctttggagcaggacttagcaaag
aaggaggaggtgctcaaggagcagagtaaagcactgcaggatgcgcagagagaaaagtca
gtgaaggaaaaagaactagtaactgaaaagtctaaattggcagagatggaggaaattaaa
tgtagacaagaaaaagaaatcgctaaactcaaagaagaactcaagtcccacaaacaagaa
agcataaaggaagtaacaaatctcaaggatgccaaacaacttttgattcaacagaaatta
gaactccaaggcaaagtggactcactgaaggcagctcttgagcaggagaaggagcgtcag
cagctaatgcgggagcagatgaggaaggaagaagagaagcggaaggaagaattttctgag
aaggaagcaaaactgcattctgaaataaaagaaaaggaagcaggagtgaagaaacatgaa
gaaaatgaggctaagcttaccatgcaggtcacaacattaaatgaaaacttgggcactgtg
aagaaggagtggcagtctagtcaacggagagttagtgagcttgagaagcagacggatgac
ttacggggtgaaatcgctgtcttagaagcaactgttcagaataatcaggatgaaagaaga
gcactgctagagagatgtcttaaaggagaaggtgaaatagaaaagcttcagaccaaagtc
ctagagttgcaaagaaagctggataacacaactgcagctgtgcaggagctgggcagagaa
aaccagtccctacagatcaaacacacacaagccctgaacagaaagtgggcagaagacaac
gaggtacagaactgcatgtcctgtgggaagtgcttctcagtcaccgtgcggcggcaccac
tgccgacagtgtggaaatatcttctgtgctgagtgttcagccaaaaacgccttaactcct
tcttcgaagaagcctgttcgtgtctgtgatgcatgtttcaatgatttgcaaggataa

DBGET integrated database retrieval system