KEGG   Rattus norvegicus (rat): 314764Help
Entry
314764            CDS       T01003                                 

Gene name
Eea1
Definition
(RefSeq) early endosome antigen 1
  KO
K12478  early endosome antigen 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    314764 (Eea1)
   04145 Phagosome
    314764 (Eea1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    314764 (Eea1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    314764 (Eea1)
 Protein recycling
   Others
    314764 (Eea1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE Atg14 IncA IBR zf-C2H2_4 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 314764
NCBI-ProteinID: NP_001101556
RGD: 1310167
Ensembl: ENSRNOG00000021681
Position
7q13
AA seq 1411 aa AA seqDB search
MFRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
QAVHDAGNDSGHGGEASLALTRDDIALLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKSDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EEKGLRAAAEQKATHLTEELSKQTTVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSEHANSEATINQLRSELAKGPQEVAVYVQEIQKLKGSVNEL
TQKSQTLMEKLQKKDLDYTHLEEKHNEEALSRKNTQAALHQRDLDCQQLQARLTASEGSL
QRIQGELREKGEAAQKLKEELREVETKHQHLKVEFKQLQQQREEKEQHGLQLQGEVSQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLEKSKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENIS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHALQQQLTQLMEKLKNQSESHKQAEENLHD
QVQEQKAHLRAAQDRVLSLETSVSELSSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTA
QRADLQNHLDTAQNALQDKQQELNKVSAQLDQVTAKFQEKQEHCTQLESHLKDYKEKHLS
LEQKAEDLEGQIKKLEANNLEVKASREQAVQSLQQQRQLSTDLELRNAELRKQLQEQKEV
VSHTKLDLQNKSEALENIKQTLTKKEEEKVVLKQEFEKLSQDSEAQHKELSDRMQAAITE
LMVMTAQKDALLAELSTTKGKLSKVSDSLQTSRSEFEKESQKGKAAVLDLEKACKELKHQ
LQQQTESALKEQSELKKSLEKERETSQQLMIELNSVKGEVTQAQNTLKQKEKEEQQLQGN
INQLKQATEQKKKQMEALQGELKNVTSQKAQLESKLQQQAAQAAQELAVEKGKLSALQST
YDKCQADLQQLQSDLYGKESELLATRQDLKCVEEKLALAQEDLISNRNQIGNQNKSIQEL
QAAKAALEQDLAKKEEVLKEQSKALQDAQREKSVKEKELVTEKSKLAEMEEIKCRQEKEI
AKLKEELKSHKQESIKEVTNLKDAKQLLIQQKLELQGKVDSLKAALEQEKERQQLMREQM
RKEEEKRKEEFSEKEAKLHSEIKEKEAGVKKHEENEAKLTMQVTTLNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMSCGKCFSVTVRRHHCRQCGNI
FCAECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggaggatcttgcagaggactcctgggagagttggctctcaaggttctgattta
gattcatcagcaactcctataaatacggtggatgtcaataatgaaagttcttcagagggt
tttatatgtccccagtgtatgaaatctcttggctcagctgatgaacttttcaaacactat
caggcagttcatgatgccggtaatgactcggggcatggtggagaggccagtcttgctttg
acacgagatgacatagcactactcaggcaagaggtccaagacctgcaggcctcacttaag
gaagaaaaatggtactcagaagaattaaagaaagaattagaaaaatatcaagggctacag
cagcaagaggctaaatctgatggattggtgactgattcatcagcagagctacagtcttta
gagcaacaattagaagaagcccaaactgagaattttaatattaagcaaatgaaagatctg
tttgaacagaaagcagctcaacttgctactgaaattgcagatataaagtcaaaatatgat
gaagaaaagggtctccgagcagctgcggaacaaaaagcgacacatttgacagaagaatta
agtaaacagacgactgtaattcaagacctgaaaactgagctgcttcagagacctggtata
gaagatgtcgctgtactaaagaaagaactggtccaagttcaaactctaatggataacatg
actttggagcgtgagagagaatctgaaaaactcaaggatgaatgtaaaaagttacagtca
gaacacgctaactcggaggctaccataaaccagctaaggagtgaacttgccaaaggcccc
caagaagttgcagtatatgtgcaggaaatacaaaaacttaaaggttcagttaatgaatta
acacaaaaaagccagaccttgatggagaaattgcagaagaaagacctggattacacccac
ttagaggagaagcataacgaagaggcactgagtagaaagaatacccaggcagccctccac
caaagggacctggattgccagcagcttcaggcaaggctaactgcatccgaaggctcgcta
cagaggatccaaggagagctcagggaaaagggagaggctgctcagaagctcaaagaagaa
ctgcgggaagtagagaccaagcaccagcatcttaaagtggagttcaagcagctgcagcag
cagcgggaagagaaggagcagcatgggctgcagctgcaaggggaagtcagtcagttacat
agcaaacttctggagactgagcgccaactaggggaagctcacggtaggctgaaggagcag
aggcaactttcaagtgagaagctgatggataaggaacagcaagtggctgacttacagctc
aagctctctcgtctggaagagcagttgaaggaaaaggtaacaaattccactgaattgcaa
catcaattagaaaaatcaaagcaacagcaccaagaacagcaagcccttcagcaaagcact
acagccaaactccgagaagctcagaatgatttagaacaagtgttacgtcagattggagat
aaggaccaaaagatccagaaccttgaagccttactacagaagagtaaagaaaatatttcc
ttactagaaaaggaaagagaagacctttatgcaaaaatccaagccggtgaaggagagact
gctgtccttaaccagttgcaagagaaaaaccatgcactacagcagcaactaactcaactg
atggagaagctgaagaatcagtcggaaagccataaacaagctgaggagaacttgcatgac
caggtacaggagcagaaggcacatcttcgagctgcacaagaccgtgttctttctctagaa
accagtgtcagtgaactaagcagtcagttaaatgaaagcaaggagaaggtttcccagctt
gacatacagattaaagccaaaactgaattattgctatcagcagaagcagcaaaaactgct
caaagagctgatcttcaaaatcatttggacacagctcaaaatgcactacaagataaacaa
caggagttaaataaggtcagtgcacagctggatcaggtcactgcaaagtttcaggagaag
caggagcattgcactcagctggaaagccatctcaaggattacaaggagaagcacctctct
ctagaacaaaaagcggaagacttagaaggccagattaagaaactagaagccaataatctt
gaagttaaagcaagcagggagcaagctgtgcagagcctacagcagcagaggcagctgagc
acagacctagagctcaggaatgcagagctcaggaagcagcttcaagagcagaaggaagta
gtatctcatacaaaattggatctacagaataaatctgaagcccttgaaaatattaaacaa
accctcactaagaaagaagaagaaaaagttgtcttgaaacaggaatttgaaaagttaagt
caagattcagaggcgcagcacaaggagctgagtgacaggatgcaagctgcgatcacagag
ctgatggtgatgacagcacagaaggacgctctcctggctgagctctccacaacaaaaggg
aaactgtcaaaagtttcagattctttacaaacctccaggagcgaatttgagaaagagagt
cagaaaggaaaggctgctgtactagacttggaaaaagcttgtaaagaattaaagcatcag
cttcaacaacaaacagaaagtgcactgaaggagcagagtgaactgaaaaagtcactggag
aaggagagagagacttctcaacagttgatgatagaactcaattcagtcaagggagaagtc
acacaggctcaaaatacattaaagcagaaggagaaagaagagcagcagcttcaggggaac
ataaatcagctgaagcaagcaactgagcaaaagaaaaagcaaatggaagctcttcaagga
gagcttaaaaacgttacttcacaaaaggcccagctggagagtaaactgcagcagcaggcg
gcacaggcagcccaggaacttgctgtggagaaaggaaagctgtcagcactgcagagcacc
tatgacaagtgccaggccgacctgcaacagctgcagtctgacctctatggcaaagagtct
gaacttctagccacaaggcaagaccttaagtgtgtagaagagaagcttgctctggcacaa
gaagacctgatttcaaacagaaatcaaattggaaaccaaaataaatcaattcaagaactg
caggctgccaaagctgctttggagcaggacttagcaaagaaggaggaggtgctcaaggag
cagagtaaagcactgcaggatgcgcagagagaaaagtcagtgaaggaaaaagaactagta
actgaaaagtctaaattggcagagatggaggaaattaaatgtagacaagaaaaagaaatc
gctaaactcaaagaagaactcaagtcccacaaacaagaaagcataaaggaagtaacaaat
ctcaaggatgccaaacaacttttgattcaacagaaattagaactccaaggcaaagtggac
tcactgaaggcagctcttgagcaggagaaggagcgtcagcagctaatgcgggagcagatg
aggaaggaagaagagaagcggaaggaagaattttctgagaaggaagcaaaactgcattct
gaaataaaagaaaaggaagcaggagtgaagaaacatgaagaaaatgaggctaagcttacc
atgcaggtcacaacattaaatgaaaacttgggcactgtgaagaaggagtggcagtctagt
caacggagagttagtgagcttgagaagcagacggatgacttacggggtgaaatcgctgtc
ttagaagcaactgttcagaataatcaggatgaaagaagagcactgctagagagatgtctt
aaaggagaaggtgaaatagaaaagcttcagaccaaagtcctagagttgcaaagaaagctg
gataacacaactgcagctgtgcaggagctgggcagagaaaaccagtccctacagatcaaa
cacacacaagccctgaacagaaagtgggcagaagacaacgaggtacagaactgcatgtcc
tgtgggaagtgcttctcagtcaccgtgcggcggcaccactgccgacagtgtggaaatatc
ttctgtgctgagtgttcagccaaaaacgccttaactccttcttcgaagaagcctgttcgt
gtctgtgatgcatgtttcaatgatttgcaaggataa

DBGET integrated database retrieval system