KEGG   Rattus norvegicus (rat): 314771Help
Entry
314771            CDS       T01003                                 

Gene name
Kera
Definition
(RefSeq) keratocan
  KO
K08123  keratocan
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    314771 (Kera)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    314771 (Kera)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9 LRR_5
Motif
Other DBs
NCBI-GeneID: 314771
NCBI-ProteinID: NP_001101557
RGD: 1305816
Ensembl: ENSRNOG00000004635
UniProt: D3ZVD7
Position
7q13
AA seq 351 aa AA seqDB search
MATPTCLILWVLLIVDTVWTQSVRQAYEVQDPEEWDVHDDFYCPRECFCPPSFPTALYCE
NRGLTEIPAIPSRIRYLYLENNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQ
LKKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSSIPQGTFSNLENLTLLDLQHNKLL
DNAFQRDTFKGLKNLMQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKV
AFLRLNHNKLSDAGLPSRGFDVSSILDLQLSHNQLTNFPRINANLQHLHLDHNKIKNVNM
SVICPSTLRAGQDAFLHGPQLSYLRLDGNEIKPPIPMDLVACFKLLQAFII
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccccaacctgtttgatactctgggtgttactcatagtagacactgtgtggaca
cagagtgtgaggcaggcctatgaagtacaggacccagaggagtgggatgtccatgatgac
ttctactgtcccagagaatgcttctgtccaccgagtttccctactgccttatactgtgag
aacagaggtctcacagaaatccctgctatcccttcaaggatccggtacctgtacctggaa
aacaacctgattgaaacaataccagagaagccatttgagaatgccacccagctgagatgg
atcaatttaaacaagaacaaaataaccaactacgggattgagaagggggccctaagtcag
ctaaagaagcttcttttcctgtttctagaagacaatgagctagaggaggtaccttcccca
ctgccaagaagtttggaacaattgcaattagccagaaacaaagtatccagcatccctcag
gggaccttcagtaatctggaaaacctgacacttcttgatctgcaacataacaaactgtta
gacaatgcctttcaaagagataccttcaaggggcttaagaatctcatgcagctaaatatg
gccaagaatgccctaaggaacatgcccccaagattaccagccaacaccatgcaacttttt
ctggacaacaactccattgaagggatacctgagaattatttcaacgtgattcctaaagtg
gccttcctgaggctcaaccacaacaagctatcagatgcaggtctcccgtcgaggggtttt
gatgtgtcctccattctagacctccaactgtctcacaaccagctcacaaactttccccga
atcaatgctaacctacagcatctacacctggatcacaacaaaattaaaaatgtgaacatg
tcggtaatatgtcccagcacactgcgcgcaggacaggatgccttccttcacggacctcaa
ctgagttacctgcgtctggatgggaatgaaatcaagccaccaatcccgatggatttagtg
gcatgcttcaaacttcttcaggctttcatcatataa

DBGET integrated database retrieval system