KEGG   Rattus norvegicus (rat): 314772Help
Entry
314772            CDS       T01003                                 

Gene name
Epyc, Dspg3
Definition
(RefSeq) epiphycan
  KO
K08127  dermatan sulfate proteoglycan 3 (PG-Lb)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    314772 (Epyc)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class III
    314772 (Epyc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT
Motif
Other DBs
NCBI-GeneID: 314772
NCBI-ProteinID: NP_001101558
RGD: 1305904
Ensembl: ENSRNOG00000004717
UniProt: G3V6L6
Position
7q13
AA seq 359 aa AA seqDB search
MKHTRIHIHWSEVNTKDSVCSVTLCHFVKSEPKKSQKMRMAARIVLVLIIIDATLAAPTT
ELFNYDSEVYDAILEDTGTFYNYEHIPDNQVETEKVAERLSGNRELLTPGPQLGDSQDED
KDEESTPRLIDGSSPQEPEFPGLLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPK
KTTYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRNLPRLQELVLRDNKI
KQLPELPNTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYITDNSLDHIPLPLPENLQAL
HLQNNDILEMHEDTFCNVKNLTYVRKALEDIRLDGNPINLSKTPQAYMCLPRLPIGSFI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaacataccagaattcatatccattggtcagaggtaaataccaaggactctgtatgc
tcagtcaccctgtgccacttcgtcaagtcggagccaaagaaatctcaaaagatgagaatg
gcagcaagaattgtcctggtacttatcatcattgatgctacattggctgcaccaaccaca
gagctctttaactatgactcagaagtgtacgatgccatcttggaggacacggggaccttt
tataactatgaacacatacctgacaaccaagtagagactgagaaagtggcagagaggctt
tctgggaacagagagctcctcactccaggcccacagctaggggacagtcaggatgaagac
aaggatgaagaatctactcccagactgatcgatggatcttccccacaggagccagaattc
ccaggacttctgggtccacacaccaatgaagactttccaacctgcctcctgtgtacttgt
ataagtaccactgtatactgtgatgaccatgaacttgatgccatccctccgctgcccaag
aagactacgtatttctattcacgcttcaacagaattaaaaagatcaacaaaaatgacttt
gcaagtttaagtgatttaaaaaggattgatctgacatccaatttaatatcagagattgat
gaagatgcattccgaaatctgcctcgcctccaagagctggtcctgcgagacaataagata
aagcagcttccagaattgccaaacactttgacatttattgatatcagcaacaacagactc
ggaaggaaaggcattaagcaagaagcatttaaagacatgtatgatctccaccatctctat
ataacggataacagcttggaccacattcctctgccactcccagaaaatctgcaggctctt
cacctccagaataatgacattctggagatgcatgaggacactttctgtaacgttaaaaat
ttaacttatgttcgtaaggcgctagaggatattcgactggatggaaacccgatcaacctc
agcaaaactcctcaggcatacatgtgtctacctcgtttgcccattggtagttttatctaa

DBGET integrated database retrieval system