KEGG   Rattus norvegicus (rat): 314787Help
Entry
314787            CDS       T01003                                 

Gene name
Cep290, RGD1311640
Definition
(RefSeq) centrosomal protein 290
  KO
K16533  centrosomal protein CEP290
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    314787 (Cep290)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     314787 (Cep290)
   TCTN-B9D complex
    314787 (Cep290)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CEP209_CC5
Motif
Other DBs
NCBI-GeneID: 314787
NCBI-ProteinID: NP_001129227
RGD: 1311640
Ensembl: ENSRNOG00000056458
UniProt: A0A0G2K715
Position
7q13
AA seq 2479 aa AA seqDB search
MPPNIKWKELIKVDPDELPRQEELADKLLISLSKVEVNELKNEDQENMIHLFRITQSLMK
MKAQEVELALEEVEKAGEEQAKFENQLKTKVMKLENELEMAQQSAGGRDTRFLRDEIRQL
EKQLEQKDRELEDMEKELDKEKKVNEQLALRNEEAENENSKLRRENKRLKKKNEQLRQDI
IDYQKQIDSQKESLLSRRGEDSDYRSQLSKKNYELVQYLDEIQTLTEANEKIEVQNQEMR
KNLEESVQEMEKMTDEYNRMKAIVHQTDTVMDQIKKENEHYRLQVRELTDLLKAKDEEDD
PVMMAVNAKVEEWKLILSSKDDEIIEYQQMLQSLRGKLKNAQLDADKSNIMALKQGIQER
DSQIKMLTEQVEQYTKEMEKNTFIIEDLKNELRKDKGTSNIYQQTHYMKIHSKVQILEEK
TKEAERTAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVIEIKNYKAQIKIRDGEI
EVLTKEINKLEMKINDVLDENEALRERAGLEPKTMIDLTEFRNSKRVKQQQYRAENQILL
KEIESLEEERLDLKRKIRQMAQERGKRSAASGLTIDDLNLTETFSHGDKIGERKLNFISF
NNMNETQSKNEFLSRELIEKEKDLERSRTVITKFQNKLKELVEENKQLEEGMKEILQAIK
DMPKDSDVKGSETSLIIPSLERLVNAMESKNAEGIFDASLHLKAQVDQLTGRNEELRQEL
RESRKEAVNYSQQLVKANLKIDHLEKETDLLRQSSGSNVVYKGIDLPDGIAPSSAYIINS
QNEYLIHLLQELDNKEKKLKHLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKDVWKADSEM
IKEEKRKLEDQAQQDAVKVKEYNNLLNALQMDSNEMKKMLSENSRKITVLQVNEKSLIRQ
YTTLVEIERQLRKENGKHKNDVISMEAEVTEKIGNLQRFKEMATFRIAALQKVVDNSVSL
SELELANKQYSELTAKYRDVLQKDNMLVQRASNLEHLACENASLKEQMEGLSKELEITKE
KLHTIEQAWEQETKLGNESNMDKAKKSMTNSDIVSISKKITVLEMKELNERQRAEHCQKM
YEHLRTSLKHMEERNFELETKFTELTKINLDAQKVEQMLRDELADSVNKAVSDADRQRIL
ELEKREVELKVEVSKLREISDIAKRQVDFLNSQQQSREKEVESLRMQLLDFQAQSDEKAL
IAKLHQHVVSLQISEATALGKLESVTSKLQKMEACNLRLEQKLDEKEQALYYARLEGRNR
ANHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTL
EMELKLKGLEELISTLKDARGAQKVINWHVKIEELRLQELKLNRELVKGKEEIKYLNNII
SEYEHTISSLEEDIVQQSKFHEERQMAWDQREVELERQLDIFDRQQNEILSAAQKFEDAT
GSMPDPSLPLPNQLEIALRKIKENIQIILKTQATCKSLEEKLKEKESALRLAEQNILSRD
KVINELRLQLPATADREKLIAELNRTELEPKSHHTMKIAHQTIANMQARLNHKEEVLKKY
QHLLEKAREEQREIVKKHEEDLHVLHHKLEQQADNSLSKFKQTAQDLIKQSPAPVPTNKH
FIRLAEMEQTVAEQDDSLSSLLTKLKRVSRDLERQKEVTEFKVREFETTKLRLQETHANE
VKKVKAEVEDLRHALAQAQKDSQNLKSELQAQKEANSRAPTTTMRNLVDRLKSQLALKEK
QQKALSRALLELRSEMTAAAEERIIAVTSQKEANLNVQQVVERHTKELKSQIEDLNENLL
KLKEALKTSKNKENSLADDLNDLNNELQKKQKAYNKILREKDGIDQENDELRRQIKRLSS
GLQSKTLIDNKQSLIDELQKKVKKLESQLERQVDDVDIKPIKEKSGKEELIRWEEGKKWQ
TKVEGMRNKLKEKEGEVHSLTKQLSTLKELFAKADKEKLTLQKKLKTTGMTVDQVLGVRA
LESEKELEELKRRNLDLENDIVYMRTHQALPRDSVVEDLHLQNRYLQEKLHTLENKLSKD
AYSQSLTSEIESDDHCQKEQELQRENLKLSSENIELKFQLEQAKKDLPRLKNQVRDLKEM
CEILKKGKMELERKLGQVRGSGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGLLT
SEKMATLEEENGKLKAELEKLKAHFGRQLSMQFESKSKGTERIMAENERLRKELKKEMQA
SEKLRIAKNNLELVNDKMAGQLEETGKRLQFAESRGPQLEGADSQSWKSIVVSRIYDTKI
KDLESDIAKKNQSITDLKQLVREATEREQKAKKYTEDLEQQIEILKNVPEGAETEQELIQ
QLQLLRLANNQLDKEKAELIHQIEVIKDQTGAESSTPDSDQLKKKINDLETHLRKSEPEK
QHLKEEIKKLKKELENFDPSFFEEIEDLKYNYKEEVKKNILLEEKLNKLSEQFGFELPSP
LAASEQREDGESPNGVPIY
NT seq 7440 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaatataaaatggaaagaattaatcaaagttgatccagatgaactgccacgt
caagaagagttggcagataaattattgatatccttatccaaggtggaagtaaatgaacta
aaaaatgaagatcaagaaaacatgatacatctgttcagaattactcagtcactaatgaag
atgaaagctcaagaagtggagctggccttggaagaagttgaaaaggctggggaagaacaa
gcaaaatttgaaaatcaattaaagacaaaagtaatgaaactggaaaatgaactggagatg
gctcagcagtctgcaggtggacgtgacactcggtttttacgtgatgaaattcgccaactt
gaaaagcagttggaacaaaaagatagagaattagaggatatggaaaaagaactggataaa
gaaaagaaagttaatgaacaattggcccttcgaaacgaggaggcagaaaatgaaaacagc
aaattaagaagagagaacaaacgtctaaagaaaaagaatgaacagcttcgtcaggacatt
attgactaccagaaacaaatagattcacaaaaagaatcacttctgtcaaggagaggagag
gacagtgactaccgatcacagttatctaaaaagaactatgaacttgttcaatatctggac
gaaatacagaccttaacagaagctaatgagaaaattgaagttcagaaccaagaaatgaga
aaaaacctagaagagtctgtacaggaaatggagaagatgactgatgaatataacaggatg
aaagcgattgtgcatcagacagatactgttatggaccagatcaaaaaagagaatgagcac
taccgccttcaagtgcgagaactcacagatcttctgaaagcaaaggatgaagaggatgat
cccgtcatgatggctgtcaatgcaaaagtggaggaatggaagttaattttgtcttctaaa
gatgatgaaatcattgaataccagcaaatgttacagagtctgagagggaaacttaaaaat
gcccagcttgatgctgataaaagtaacattatggctctgaagcagggtatccaggaacga
gacagtcaaattaagatgcttactgaacaagtagaacagtatacgaaagaaatggaaaaa
aatacttttattattgaagatttgaaaaatgagctccgaaaagacaaaggtacttcaaac
atttatcagcagactcattatatgaaaatccactcaaaggtacaaattttagaagagaaa
acaaaagaggccgagagaacagctgagctggctgaggctgatgctagggagaaggacaaa
gaattggttgaggctctgaagagattaaaagattatgaatctggagtatatggcttagaa
gatgcggttattgaaataaagaattataaagcccaaattaaaataagagatggagagatt
gaagtgttgaccaaggagatcaataagcttgagatgaagatcaatgatgtccttgatgaa
aatgaagctcttagagagcgggccggccttgaacccaagacaatgattgatctgactgaa
tttagaaatagtaaacgcgtaaagcagcagcagtacagagctgagaaccagattcttttg
aaagagatcgaaagtctagaggaagaacgtcttgacttgaagagaaaaattcgtcaaatg
gctcaagaaagaggcaaaaggagtgcagcctcaggattaaccattgatgatctgaaccta
actgaaaccttttctcacggggataaaataggagaaagaaagctaaattttataagcttc
aataatatgaatgaaacacaatcaaagaatgaatttctttcaagagaattgattgaaaag
gaaaaagatttagaaagaagtaggacagtaattactaaatttcagaataaactaaaagaa
ttagttgaagaaaataagcaacttgaagaaggtatgaaggaaattttgcaagccattaag
gacatgccaaaggattctgatgtgaaaggaagtgaaacatctttaatcatcccaagtctt
gaaagactggttaatgctatggaatcaaagaatgcagaaggaatcttcgatgctagtttg
catctgaaagcccaagttgatcaacttacaggaaggaatgaagaattaaggcaagaactc
agggaatctcggaaagaagcagtaaattattcccagcagttggtaaaagcaaacttaaag
attgatcaccttgagaaagaaacagaccttctgcgtcaatcttcaggctccaatgtagtt
tacaaaggcatagacttacctgacgggatagcaccatctagtgcctacatcatcaactct
cagaatgagtatttaatacatcttttgcaggaactagacaataaagaaaagaaattaaag
cacttagaagattctcttgaagattataacagaaaatttgcagtgattcgacatcaacaa
agtttattatataaagaatatctaagtgaaaaggatgtttggaaagcagattctgagatg
ataaaagaggagaagagaaagctggaggatcaggctcagcaggacgctgtgaaagtaaaa
gagtataataatttgctcaatgcccttcagatggactcgaatgaaatgaagaaaatgctt
tcagaaaacagtaggaaaatcacggttctgcaagtgaatgagaagtccctcatccggcag
tatacaaccttagtggagatagagcggcaacttagaaaagaaaacgggaaacacaagaat
gacgtcatatccatggaagccgaagttactgaaaaaattggaaatttgcagagatttaag
gaaatggccaccttcaggattgcagctcttcagaaagttgtagataacagtgtttctttg
tctgaactagaactagccaataaacagtacagtgagctgactgcgaagtacagggacgtc
ttgcagaaagataacatgcttgttcagagagcaagtaacttagagcacctagcgtgtgaa
aatgcatcgctgaaagaacagatggaggggctcagtaaagagctggagatcacaaaggaa
aagctccataccatcgaacaagcctgggaacaagaaacgaagttaggaaatgaatcaaac
atggataaggcaaagaaatcaatgacaaatagtgacattgtttctatttcaaaaaaaatc
actgtgttggagatgaaagaattaaatgaaaggcagagggctgaacactgtcagaaaatg
tatgagcacctaagaacttcattgaagcacatggaagaacgaaactttgaattggaaacc
aagttcactgagcttaccaaaatcaacctggatgcacagaaggtggagcagatgctgaga
gatgaattagctgatagtgtgaacaaggcagtgagcgacgccgatagacagcggattcta
gaactggagaagcgtgaagtggagctcaaagtggaagtgtctaaactgagagagatttct
gatattgccaaaagacaagttgattttttgaattcacaacaacagtccagggaaaaggaa
gtggaatccctcagaatgcagctgctggacttccaggcacaatctgatgaaaaggcgcta
attgccaaattgcaccaacacgttgtctctcttcaaattagtgaggccacagctcttggt
aagttagagtcagttacgtctaaactccagaagatggaagcctgcaacttgcgcttagaa
cagaaactggacgaaaaggagcaggctctctactacgcccgcttggagggtagaaacaga
gccaatcacctgcgccagaccattcagtctctacgacgacagttcagtggcgctttaccc
ttggctcagcaggaaaagttctccaaaacaatgattcagttgcaaaatgacaaacttaag
ataatgcaagaaatgaaaaattctcaacaagaacacagaaatatggaaaacaaaacattg
gaaatggaattaaaattaaaaggcttagaagaattaataagcactttaaaggatgccagg
ggagcccagaaggtaatcaattggcatgtgaaaatagaagaacttcgccttcaagaactt
aagctaaatagagagctagtcaagggtaaagaagaaatcaaatatttgaataatatcatc
tcggaatatgaacatacaatcagcagtctggaggaagacattgttcagcagagcaagttt
catgaagaaagacaaatggcttgggatcaaagagaagttgagctggaacgccagttagac
atttttgatcgtcagcaaaatgaaatactcagtgcagcacaaaagtttgaagacgcgaca
ggatcaatgcctgaccccagcttgccccttccaaaccaacttgaaattgctctaagaaaa
attaaggagaatattcaaataattcttaaaacacaagcaacttgcaagtcactagaagag
aaactaaaagaaaaagaatctgctttgcggttggcagagcaaaatattctgtcaagagac
aaagtaatcaatgaactgaggcttcaattgcctgccacagctgatcgagaaaaacttata
gctgagctcaacagaacagagctggagccaaaatctcatcacacgatgaaaattgcccat
caaaccattgccaacatgcaggcgaggttaaatcacaaggaagaagtattgaagaagtac
cagcatcttttggagaaagccagagaggagcaaagagaaattgttaagaaacatgaggaa
gaccttcatgttcttcatcacaaattagagcaacaggccgataattcactcagtaaattc
aaacagacagctcaggatttaattaagcagtctcctgctccagtacccaccaacaagcat
ttcattcgcctggccgagatggaacagacagtagcagaacaagatgactctctctcttca
cttttgaccaaactgaagagagtatcaagagatttggaaagacaaaaagaagtcactgag
ttcaaagtcagagaatttgaaactaccaaattacggctccaagaaactcatgccaacgaa
gtaaagaaagtgaaagcagaggtagaggacttaaggcatgctctagcccaagcacagaag
gactcccagaatttaaagtctgaactccaggctcagaaagaagcaaactccagggcacca
acaaccacaatgaggaatctagtagacaggctaaagagccagctagctttgaaagagaag
cagcaaaaggcacttagccgagccctgttggaacttcggtcagaaatgacagcagcagct
gaagaacgtataattgctgtaacttctcaaaaagaggcaaatctcaatgttcaacaagtt
gttgagcggcatactaaagaactaaagtcacaaattgaagatttaaatgaaaatcttttg
aaattaaaagaagctcttaagacaagtaaaaacaaagaaaattcactagctgatgactta
aatgatttaaataatgaactgcaaaaaaagcaaaaagcttataataaaatccttagagag
aaagatggaattgatcaagaaaatgatgaactgagacgacagattaaaagactgtccagt
gggctacagagcaaaactctgatagataataagcaaagtttaatcgatgaacttcagaag
aaagttaaaaaacttgaaagccaactggaaagacaggtggatgacgtagacataaagcct
ataaaggaaaagagtggtaaagaagaattaattaggtgggaagaaggtaagaaatggcaa
accaaagtagagggaatgcgcaacaaattaaaggagaaagaaggagaggtccacagcctg
acaaagcagctgagcaccttaaaggaactttttgccaaagctgataaagagaagcttact
ttgcagaagaaactgaaaacaacaggaatgactgttgaccaggtcttaggagtgcgagct
ttggagtcggaaaaggagttggaagagctaaaaaggagaaatctggacttagaaaatgac
atagtatatatgaggacccaccaggctcttccacgagattctgttgtagaagacttacac
ttacaaaatagataccttcaagaaaaacttcatactttagaaaataaactttccaaggat
gcatattctcagtctttgacttcagaaatagaatcagatgatcattgtcaaaaagaacaa
gagcttcagagggaaaatttgaaattgtcatctgaaaatattgaactgaaatttcaactg
gaacaagcaaagaaagacttgccgagactaaagaatcaagtaagagatttgaaggaaatg
tgtgaaattcttaagaaagggaaaatggaacttgaacggaagcttggtcaggtcagaggg
tctggtagaagtgggaagacaatcccagagctagaaaaaactattgggttaatgaagaaa
gttgttgaaaaagtccaaagagaaaacgaacaattgaaaaaggcatcaggactactgact
agtgaaaaaatggctactcttgaggaagaaaatggaaaattaaaggctgaattagaaaag
ctgaaagctcactttggacgtcagttgagcatgcagtttgaatctaagagcaaagggact
gagagaattatggccgaaaatgagcggcttcggaaagaacttaagaaagaaatgcaagct
tctgagaaactgcgcatagctaagaacaacttagagctggtgaatgacaagatggcgggt
caactagaagagactgggaagagattgcagtttgcagaaagtagaggtccacagctggaa
ggtgctgacagccagagctggaagtcaattgtggtttcaagaatatatgacaccaagata
aaagacctcgaaagtgacattgccaaaaagaaccaaagtatcaccgaccttaaacagctt
gtaagagaagcaacagagagagaacagaaagccaagaagtacactgaagaccttgaacaa
cagattgagatcctcaaaaatgttcctgaaggagctgaaacagagcaagagcttatacag
cagctccagcttcttagactagccaataaccagctggataaagaaaaagcagagctaatc
catcagatagaagttatcaaggaccaaactggagccgaaagtagcacacctgattctgat
caactgaagaaaaagataaatgacctggagacacacctcagaaagtcagagccagaaaag
caacatttgaaggaggaaattaaaaagctgaaaaaagaactggaaaattttgacccttca
ttctttgaagaaattgaagacctgaagtacaattataaggaagaagtgaagaaaaatatt
ctcttagaagagaagttaaacaaactttctgaacaatttggatttgaattgcctagccca
cttgctgcttctgaacaacgggaagatggagaaagtcctaatggcgtcccgatttattaa

DBGET integrated database retrieval system