KEGG   Rattus norvegicus (rat): 314800
Entry
314800            CDS       T01003                                 

Gene name
Acss3, RGD1307051
Definition
(RefSeq) acyl-CoA synthetase short-chain family member 3
  KO
K01908  propionyl-CoA synthetase [EC:6.2.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    314800 (Acss3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    314800 (Acss3)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.17  propionate---CoA ligase
     314800 (Acss3)
Lipid biosynthesis proteins [BR:rno01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   314800 (Acss3)
SSDB
Motif
Pfam: AMP-binding ACAS_N
Other DBs
NCBI-GeneID: 314800
NCBI-ProteinID: NP_001101561
RGD: 1307051
Ensembl: ENSRNOG00000004448
UniProt: D3ZGU2
Position
7q21
AA seq 498 aa
MKPSWLQCRKVTGAGTLGAPLPGSPSVRGAGVARRALVAGFGGRGCRALTTSSGGGEYKT
HFAASVADPERFWGKAAEQISWYKPWTKTLENRYPPSTSWFVEGMLNICYNAIDRHIENG
QGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLVKQGVKKGDTVVIYMPMIPQAIYA
MLACARIGAIHSLIFGGFASKELSTRIDHVKPKVVVTASFGIEPGRKVEYMPLLEEALRI
GQHKPDRLLIYNRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTG
LPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVL
YEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVA
GERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVPGYNG
SYLSYNSVMSLTSPAMKK
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaagccctcctggttgcaatgtcgcaaagtaacaggcgccgggacgcttggggcacct
ctgccaggatccccttcagtaagaggagctggtgtggcccgaagggctttggtggccggg
ttcgggggcaggggctgcagggctctgaccacaagcagcggtggtggcgagtacaagacc
cactttgcagcctctgtggctgacccggagagattctggggtaaagctgctgagcagatc
agttggtacaagccctggaccaaaacactagagaacagatacccgccttccactagttgg
tttgtggaagggatgctcaacatttgttacaatgctattgatcggcacatcgaaaatggc
caaggggataagatcgctatcatctatgacagtcccgttacagacaccaaagcaactatc
tcctataaggaagtcttggagcaggtctctaagctggctggtgtcttggtcaagcaaggt
gtcaagaaaggtgatactgtggtcatctacatgcccatgatcccacaagcaatatacgcc
atgttggcatgtgcgaggataggcgcaattcacagtctcatattcggcgggtttgcatcc
aaggaattaagtacacgcattgatcatgtgaagcctaaggtggttgttacagcatcattc
ggcattgagcctgggaggaaggtagagtacatgccccttctagaagaagctctcagaata
ggacaacacaaaccagacagactcctcatttacaaccgtccaaatatggagaaagttcct
ttgatgtcaggtcgtgatcttgattgggaagaagaaatggcaaaagcccagtcacatgac
tgcgtgcctgttctctcagagcatcccttgtacattctctacacatctggaacaactggc
ctgcctaagggtgtagttagacccactgggggatatgctgtaatgttgaactggacaatg
tcttccatatatggacttaaacctggagaggtatggtgggcagcttctgacttaggctgg
gttgtcggacattcctatatttgctatggtcctcttctacatggaaacacaacagtttta
tatgaggggaaacctgtgggaacaccggatgctggcgcttatttccgtgtgctcgcagag
catggagtggctgccttgtttacagcaccaaccgcaattagagccatccgtcaacaggac
cctggggcagccttggggaagcagtactctctgacaaggttcaagacactgtttgtggct
ggggaaagatgtgatgtggagaccctagagtggtccaaaaaagtcttccgcgttcctgtc
ctagaccactggtggcaaacagagactggatcccccatcacagcatcatgtatcggacta
ggcaactccaaaacacccccaccaggacaagcaggaaaatgtgttccaggatacaatgga
agctacctgtcttataattctgtgatgtctctgacttctcctgctatgaaaaaatga

DBGET integrated database retrieval system