KEGG   Rattus norvegicus (rat): 314818Help
Entry
314818            CDS       T01003                                 

Gene name
E2f7, E2F-7
Definition
(RefSeq) E2F transcription factor 7
  KO
K09391  transcription factor E2F7/8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    314818 (E2f7)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    314818 (E2f7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_TDP TrmB
Motif
Other DBs
NCBI-GeneID: 314818
NCBI-ProteinID: NP_001101562
RGD: 1310258
Ensembl: ENSRNOG00000026252
UniProt: A0A0A0MY02
Position
7q22
AA seq 514 aa AA seqDB search
MEVNCLTLKDLISPRQTRLDFAVEDAETAQKENIFVDRSRMTPKTPMKNEPIDLSKQRIF
TPERSPITPVKLVDRQPQVEPWTPTANLKMLISAASPDIRDREKKKELFRPIENKGDAFV
NSLQLDVVGDSAVDDYEKRRPSRKQKSLGLLCQKFLARYPSYPLSTEKTTISLDEVAVSL
GVERRRIYDIVNVLESLHLVSRVAKNQYGWHGRHSLPKTLRTLQRLGEEQKYEEQMACLQ
QKELDLMEYRFGERRKDGSPDPRDQHLLDFSESDYPSSSANSRKDKSLRIMSQKFVMLFL
VSKTKIVTLDVAAKILIEESQDTPDHSKFKTKVRRLYDIANVLTSLALIKKVHVTEERGR
KPAFKWIGPVDFSSIDEELLDVSASVLPELKKETYGQIRVCAKERLARYGSFNTVQTSEK
IQRKVNSEPSSPQGGKQGPAYSLEIGSLAAIYRQKVEDSSQGEAFVNKRAAPPASVLDPT
LPVDSEYCVKPLAQPVFSVAQTENPQIPQTSPFL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggaggtaaattgtttaacactaaaagacttgatcagccccaggcagaccagactagat
tttgccgttgaagatgcagagaccgcacaaaaggaaaatatattcgtcgatcgatcaagg
atgaccccaaagacgccaatgaaaaatgaacccatcgatctgtcaaagcaaagaatcttt
actccggaaagaagtcccattactccggtaaagctggtggaccggcagccgcaggtggaa
ccgtggacacccacggccaacctgaagatgctcatcagtgcggccagcccagacataagg
gaccgggagaagaaaaaggagctgttcagacccattgagaataagggggatgcatttgtg
aactccctgcagcttgatgtggttggcgacagtgctgtggatgactacgagaagcgaagg
ccaagcaggaaacagaagagcttggggctgctgtgccagaagtttctagctcgctatcca
agctaccccttgtccacggagaaaaccaccatctccctggatgaggtcgccgtcagcctt
ggtgtggaaaggagacgcatctatgacatcgtaaatgtgctggagtctctgcatctggtc
agccgggtagctaagaatcagtatggttggcatggtcggcacagccttcccaaaaccctg
cggaccctacagagactgggagaggaacagaaatacgaggagcagatggcctgcctccag
cagaaggagctggacctgatggagtataggtttggagaacgcaggaaagatgggtctcca
gatccccgagatcaacacctactcgatttttctgaatccgactacccctcttcatctgca
aacagtcgaaaagataaatctctaagaattatgagccagaagtttgtcatgctgttcctc
gtctctaaaaccaagattgttaccctggatgtagctgccaaaatcctcatagaagaaagc
caagataccccggaccacagtaaattcaaaacaaaggtacggaggctctatgacatagcc
aatgtgctgaccagcttggctctgataaagaaagttcacgtgacagaagagcgaggccgc
aaaccagccttcaaatggatcgggcccgtggacttcagctccattgatgaagaactcttg
gacgtctctgcatctgtcttaccggaactgaagaaggaaacatatggtcagattcgagtg
tgtgcaaaagagaggctggcgcggtacggttcctttaacacggttcagacatctgagaag
atacagagaaaagtgaactccgagcccagcagcccacagggaggaaaacaagggccagcc
tattccctggaaattgggagtctggccgccatctacagacagaaagtagaagacagttcg
cagggggaagcctttgtcaataagagagctgcacctccagcaagtgtcttggaccctacc
ctccctgttgactccgaatactgtgttaagcctttagcccagccagtattttctgtcgcg
caaacagaaaaccctcaaattccacagacctcgcctttcctgtga

DBGET integrated database retrieval system