KEGG   Rattus norvegicus (rat): 314850
Entry
314850            CDS       T01003                                 

Gene name
Frs2
Definition
(RefSeq) fibroblast growth factor receptor substrate 2
  KO
K12461  fibroblast growth factor receptor substrate 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    314850 (Frs2)
  09159 Environmental adaptation
   04714 Thermogenesis
    314850 (Frs2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    314850 (Frs2)
SSDB
Motif
Pfam: IRS
Other DBs
NCBI-GeneID: 314850
NCBI-ProteinID: NP_001101567
RGD: 1308201
Ensembl: ENSRNOG00000005642
UniProt: D4A244
Position
7q22
AA seq 508 aa
MGSCCSCPEKDTVPDNHRNKFKVINVDDDGNELGSGVMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NSHQTELEVPRTPRTPTTPGLGAQSLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRASVHIPPEARVSNAESNTPKEEPSNTEDRDP
HVLLKPEGVKFVLGPTPVQKQLMEKEKLEQLGKDQVSGSGASSTEWDTGYDSDERRDVPP
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRPALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIDCSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgggtagctgttgtagctgtccagagaaagacactgtcccagataaccatcggaacaag
tttaaggtcattaatgtggatgacgatgggaatgagctaggctctggtgtaatggagctc
acagacacggagctgattctgtatacccggaaacgcgactcggtgaagtggcactacctc
tgcctacgacgatatggctatgactcaaatctattttcttttgaaagtggtcgaaggtgt
caaactggacaaggaatttttgcttttaaatgtgcccgtgcagaagaattatttaacatg
ttgcaagagattatgcaaaataatagtataaatgtggtggaagagcccgttgtagaaagg
aatagtcatcagacagaattggaagtccctagaacacctcgaacacctacaactccaggg
cttggtgctcagagcctacctaatgggtatcctcgatacccctcgttcggagacgcttca
tcccacccctcaagccggcatccttctgtgggaagtgcccgcttaccttcagtcggcgaa
gagtccacacaccctttgctggtggctgaggaacaagtacatacttatgtaaacactaca
ggtgtacaagaagaacggaaaaaccgtgccagtgtgcacattcccccagaggcaagagtt
tctaatgccgaaagcaacacaccaaaagaagagccaagtaatactgaagacagggacccg
cacgtgcttcttaagcctgaaggcgtcaagtttgttttaggaccaacccctgttcagaag
cagttaatggaaaaggagaaactggagcagcttggaaaagaccaagtcagtgggagtggt
gcgagtagcacggaatgggacactggctatgacagcgatgaacgcagagatgtgccccct
gttaacaaactggtgtatgaaaatataaacgggctgtctatccctagtgcctcaggggtc
aggagaggtcgtctgacatctaccagcacctcagacacccagaatatcaacaactcagcg
cagagaagacctgcactattaaactatgaaaatttaccatctttgcctcctgtgtgggaa
gcccgcaagctcagtagggatgaagacgacaatttaggaccaaagaccccatctctaaat
ggctaccataataatctagatccaatgcataactatgttaatacagagaatgtaacagtg
ccggcaagtgctcacaaaatagactgttcaaggcgtagggattgcacacccacagtcttt
aactttgatatcaggcgccctagtttagaacacaggcaactcaattatatacaggtggac
ttggaagggggcagtgactctgacaaccctcagaccccaaaaacaccgaccactcccctc
ccacagacccccacccggcgcacagagctgtatgccgtgatagacattgagagaactgct
gctatgtccaacttgcagaaagcgctgcctcgggatgacggcacgtccaggaagactaga
cacaatagtactgacctgcccatgtga

DBGET integrated database retrieval system