KEGG   Rattus norvegicus (rat): 314859Help
Entry
314859            CDS       T01003                                 

Gene name
Mdm1
Definition
(RefSeq) Mdm1 nuclear protein
  KO
K17886  nuclear protein MDM1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    314859 (Mdm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MDM1
Motif
Other DBs
NCBI-GeneID: 314859
NCBI-ProteinID: NP_001017459
RGD: 1561092
Ensembl: ENSRNOG00000007286
UniProt: Q5PQN4
Position
7q22
AA seq 719 aa AA seqDB search
MPVRFKGLSEYQRNFLWKKSYLSESYNPSVGQKYTWAGLRSDQLGITKEPSFISKRRVPY
YDPQISKYLEWNGTVRENDALAPPEPQIIRTPKPQEAEQREDANHETVLPQEASRVPKRT
RSHSADSRAEGASDGVEKHQDVTKNHSLVNADVELRPSTKPLPESIEPRLDRHLRKKAGL
AVVPLNNALRNSEYQRQFVWKTCKETAPVCAANQVFRNKSQVIPQFQGNTFIHESEYKRN
FKGLTPVKEPKLREYLKGNSSFEILSPEKKADEPLDLEVDMASEDSDQPIKKPAPWRHQR
LGKVNSEYRAKFLSPAQYLYKAGAWTRVKESLSHQGSLNAMWYAEVKELREKAESYRKRV
QGTHFSRDHLNQIMSDSNCCWDVSSVASSEGTISSNIQALDLAGDLTSHRTLQKHPPTKL
EEKKVALAEQPLENTIRSLELPEAPTMARRKLAWDAAEGTQKEDTQEEPSGEEDGREARG
KDKQVCAGELQKVDMQTSKADGPTEGSETSSVSSGKGGRLPTPRLRELGIQRTHHDLTTP
AVGGAVLVSPAKAKPSALEQRRRPSSQDGLETLKKGITKKGKHRPLSLLTSPTAGMKTVD
PLPLRQDCDANVLRVAEGTLPVLKNLDHQTNTPGQPSPCTLPYCHPSSRIQGRLRDPEFQ
HNIGKPRMNNTQLLPHGAFNDEDADRLSEISARSAVSSLQAFQTLARAQKRKENFWGKP
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcgcttcaaggggctgagtgaataccagagaaacttcctgtggaaaaagtcc
tatttgtcagagtcctataatccctcagtggggcaaaagtacacatgggcaggacttaga
tcggaccagttggggatcacgaaagaaccgagttttatttcaaaaagaagagtcccttac
tatgaccctcagatttcaaaatacctggagtggaatggaactgtccgagagaatgatgct
cttgccccaccagaaccccagattatccgaaccccaaaaccacaagaagcagagcaaaga
gaagatgctaaccacgaaacagttctcccacaagaggcttccagggtccccaagagaact
cgatctcattctgcagactccagagctgaaggggcttcagacggtgtggaaaagcaccag
gatgtcacaaaaaaccattcactagttaatgcagacgtggagctgagaccttccaccaaa
cctcttcctgagagtatagaacccaggttggacaggcatcttcgcaagaaagctggattg
gccgttgtccccttgaataatgccttgagaaattctgaataccagaggcagtttgtttgg
aagacctgtaaagaaactgctccagtgtgtgcagccaatcaggttttccgtaataaaagc
caagttattccacagttccaaggcaatacattcatccacgaaagtgaatataagcgaaat
ttcaagggtttaactccagtgaaggaaccgaagttgagagagtatttgaaaggaaacagc
agttttgagatattgtctccagagaagaaggcagacgagcctttagacttagaagtagac
atggcgtcggaagactcagaccagcctataaagaagcctgctccttggagacatcaaagg
cttggaaaggtgaattctgaatatagagcaaaatttctgagcccagcccagtatttatat
aaggctggagcttggacgcgtgtgaaggagagcttgtcgcaccagggttctctaaatgcc
atgtggtatgcagaggttaaggagctccgggaaaaggctgagtcctatcggaagcgagtt
caggggacgcatttttctcgggaccatctgaatcagattatgtctgacagcaactgctgt
tgggatgtctcctcagtcgcaagctcggaaggcaccattagtagcaacatccaagccctg
gatcttgctggagatcttacaagccacaggaccctccagaaacaccctcctaccaaactg
gaagagaaaaaagttgcattggcagaacagcccctggaaaataccatcaggagcctggag
ctgccagaggctcccaccatggccaggaggaagttggcttgggatgctgcggagggcaca
cagaaggaagatacccaggaggagcccagtggggaggaggacgggagagaggccagagga
aaggacaagcaggtctgtgcaggagagctacagaaagtggacatgcagacatctaaggca
gacggaccgacagaagggtcagaaacgtcttccgtttcctcagggaagggaggcagactt
ccgacaccaagactgagagagctcggtatccagcggactcaccatgatctcacaactcca
gctgttggtggagcggtcttagtgtctccagctaaagcgaagccgtcagccctggagcaa
aggaggagaccatcctcccaagatggcttggagactctgaagaaaggcattactaagaaa
ggaaaacaccgtcctctctctctcctgacttctcctactgccggcatgaaaacagttgat
cccctgcctttgcgacaagattgtgacgccaatgtgctcagagttgctgagggtactctt
cctgttttgaaaaatttggaccatcagaccaacactcctggacagccttctccatgtacc
ctgccttactgtcatccttccagcaggatccaggggcgtcttcgagaccctgaatttcag
cataacataggaaaaccaaggatgaacaacacgcagttacttccacatggcgcctttaat
gacgaagatgcagacagactgtctgagatctccgctcgctctgcggtttccagcctccag
gctttccagactttagcccgagctcagaaaagaaaggagaatttctggggcaaaccgtaa

DBGET integrated database retrieval system