KEGG   Rattus norvegicus (rat): 314862Help
Entry
314862            CDS       T01003                                 

Gene name
Dyrk2
Definition
(RefSeq) dual specificity tyrosine phosphorylation regulated kinase 2
  KO
K18669  dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    314862 (Dyrk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     314862 (Dyrk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   314862 (Dyrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Choline_kinase RIO1 Kinase-like YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 314862
NCBI-ProteinID: NP_001101570
RGD: 1312039
Ensembl: ENSRNOG00000007821
UniProt: F1LYY7
Position
7q22
AA seq 527 aa AA seqDB search
MNDHLHISHSHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLESIHRRQ
GSSTSLKSMEGMGKVKASPMTPEQAMKQYIQKLTAFEHHEIFSYPEIYFLGPNAKKRQGM
TGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVR
NEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKK
NKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCY
EHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACM
IELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESR
EWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTAVKRVT
ESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccacctccacatcagccacagccacggacagatccaggttcagcagctgttc
gaggacaacagtaacaaaaggacagtgctcacaacccaacccaatgggcttacgacggtg
ggcaagacgggcttgcctgtggtgcctgagcggcagctggagagcattcacagacggcag
gggagttccacctctctgaagtccatggaaggcatggggaaggtaaaagccagccccatg
acacctgaacaagcgatgaagcaatacattcaaaaactcacagccttcgaacaccacgag
attttcagctaccccgaaatctacttcttgggtccaaatgcaaagaagcgccaaggcatg
acaggtggacccaacaatggcggttatgatgacgaccagggatcatacgtgcaggtgccc
cacgatcacgtggcttacaggtacgaggtcctcaaagtcatcgggaaggggagctttggg
caggtggtcaaggcctatgaccacaaagtccaccagcacgtggccctgaagatggtgcgg
aacgagaagcgcttccaccggcaggcggcagaggagatccggatcttggaacacctacgg
aagcaggacaaggacaacaccatgaacgtcattcacatgctggagaacttcaccttccgc
aaccatatctgcatgacgttcgagctgctgagcatgaacctctatgagctcatcaagaag
aataagttccaaggcttcagcctgcctctggtgcgcaagttcgcccactccattctgcag
tgcttggatgctttgcacaaaaacagaataatccactgtgaccttaagcccgagaacatt
ttgttaaagcagcagggtcggagcagtattaaagtgattgactttggctccagttgttat
gagcaccagcgcgtctacacgtacatccagtcgcgcttttaccgggctccggaagtgatc
cttggagccaggtatggcatgcccattgacatgtggagcctgggttgcatcctcgcggaa
cttctgacgggttaccccctcttgcctggggaggatgaaggggaccagctagcttgtatg
atcgagcttttgggcatgccctctcaaaaactcctggatgcttccaaacgagccaaaaat
ttcgtgagctctaagggttacccccgatactgcactgttacaactctttcggatggctct
gtggtactcaacggaggcagatcccggagagggaaactgaggggtccgccagagagcaga
gagtgggggaatgcactgaagggatgtgatgatcctcttttccttgacttcttaaaacag
tgtttggagtgggatcccgcggtccgaatgaccccgggacaggctctacggcacccgtgg
cttaggaggcgtttgccaaagcctccgaccggggagaagactgcggtgaagagggtcaca
gagagtactggtgctatcacctccatttccaagttacctccaccttccagctcagcttcc
aagctgaggactaatttggcacagatgacagatgccaatgggaatattcagcagaggaca
gtgttgccgaaactcgttagctga

DBGET integrated database retrieval system