KEGG   Rattus norvegicus (rat): 314979Help
Entry
314979            CDS       T01003                                 

Gene name
Deptor, Depdc6, RGD1561030
Definition
(RefSeq) DEP domain containing MTOR-interacting protein
  KO
K20402  DEP domain-containing mTOR-interacting protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    314979 (Deptor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    314979 (Deptor)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314979 (Deptor)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    314979 (Deptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEP PDZ_6 PDZ_2 PDZ
Motif
Other DBs
NCBI-GeneID: 314979
NCBI-ProteinID: XP_001066889
RGD: 1561030
Ensembl: ENSRNOG00000004328
UniProt: F1M8Y4
Position
7q32
AA seq 409 aa AA seqDB search
MEEGSSGGSGGSDSNAGGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTY
PNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKD
DGTFPLDNEVKAFMRGQRLYEKLMSPETTLLQPREEEGVKYERTFMASEFLDWLVQEGEA
TTRKEAEQLCHRLMEHSIIQHVSNKHPFVDSNLLYQFRMNFRRRRRLMELLNEKSPSSQE
THDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSP
PVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGP
AAAAGMKVCQFVVSVNGLNVLNVDYRTVSNLILTGPRTIVMEVMEELEC
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggaggagggcagcagcggcggcagtggtggcagcgacagtaacgccggcgggagtggc
ggggcacagcagagagagctggaacgcatggctgaagtcctagttacgggagagcagctc
cggctgcggctccatgaagaaaaggttattaaagatagacggcaccatctcaaaacctac
ccaaactgctttgttgcaaaagaactcatcgactggctcattgagcacaaggaggcctct
gaccgagagacggcgataaaactcatgcagaaattagctgaccggggcatcattcatcac
gtgtgtgatgagcacaaggagttcaaggacgtaaagctcttctaccgctttaggaaggac
gatgggaccttcccactggacaacgaggtgaaggccttcatgagagggcagaggctgtat
gaaaaactgatgagccctgaaactacactcctccagcctagggaagaggagggggtgaag
tatgagcgaaccttcatggcatctgaattcctggactggctggttcaggaaggagaagcc
acaacgaggaaagaggcagagcagctttgccaccggctcatggagcacagcatcatacag
catgtgtctaacaagcacccatttgtggacagcaacctcctctaccagttcagaatgaac
ttccgtcggaggcgaagactgatggagctgctcaatgagaagtccccgtcctctcaggag
acacatgacagtcccttctgtctgaggaagcagagccacgacaatcggaaatctaccagc
tttatgtcagtcagccccagcaaggagatcaagattgtgtctgccgtgcggaggagcagc
atgagcagctgtggcagcagtggctacttcagcagcagcccgacgctcagcagcagcccc
cctgtgctctgcaaccccaaatctgtgctgaagagacctgtcacttctgaagaactcttg
acccccggggctccatatgcaaggaagacattcacgattgttggtgacgcagttggctgg
ggctttgtggttcgaggaagtaaaccatgccacatccaggctgtggaccccagcggacct
gcagctgctgcagggatgaaggtctgtcagtttgtcgtctcggtgaatggcctcaacgtg
ctgaatgtagactaccgcaccgtgagcaacctgattctgacaggcccgaggacaattgtc
atggaagtcatggaggagttagaatgctga

DBGET integrated database retrieval system