KEGG   Rattus norvegicus (rat): 315084
Entry
315084            CDS       T01003                                 

Gene name
Gsdmd
Definition
(RefSeq) gasdermin-D
  KO
K20917  gasdermin-D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    315084 (Gsdmd)
   04621 NOD-like receptor signaling pathway
    315084 (Gsdmd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    315084 (Gsdmd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    315084 (Gsdmd)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   315084 (Gsdmd)
SSDB
Motif
Pfam: Gasdermin Gasdermin_C
Other DBs
NCBI-GeneID: 315084
NCBI-ProteinID: NP_001124025
RGD: 1307261
Ensembl: ENSRNOG00000007728
Vega: OTTRNOG00000000275
Position
7
AA seq 451 aa
MPSAFAGVVKNVIKEVGGSGGELIPVDCLRNSTSFKPYCLLSRKLSSSWFWKPRYTCVNL
SIKDILEPSAPEPVSGSSSASMNVCMLRVTQQTWEIMQRERHLQQPENKILQQLRNRGDD
VFVVTEVLQTKEEVQITQVHSHEGSGQFTLPGASCLQGEGKGHQSRKKMVTIPAGSILAF
RVAQLLIGSEWDILLISNEKKRTFELPSSGHKGAVGQRRHDFSLLAVLHSIGERLSLKSD
GTNEEEVIREDFQGLRAEVEAGSSELRSLEMELRQQLLVDIGRILQDQPSMEALEASLEQ
GLCSGEQVEPLEGPAGSILECLVLDSGELVPELAAPVFYLLGALAGLSETQQQLLATKAL
EATVLSKELELVKHVLEQSTPWQEQRSVPLPSRLLGDSWDEEALTWVLLEECGLTLQVEP
PQVYWEPTSQGPICALYASLALLSSLGQKSC
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgccgtcagcctttgcgggagtggtcaagaatgtgatcaaagaggtgggcggcagcgga
ggagagctcatcccagtggactgccttcggaattctaccagcttcaagccctactgcctc
ctgagcaggaaactctcaagctcatggttctggaaaccccgttatacatgtgtcaacctg
tcaatcaaggacatcctggagcccagtgctccagaaccagtgtctggcagttccagtgcc
tccatgaatgtgtgtatgctgcgtgtgactcagcagacctgggagatcatgcaacgtgaa
aggcacctgcagcagcctgaaaacaaaatcctgcaacagctgcggaatcgtggggatgac
gtgtttgtggtgaccgaggtgctgcagacaaaggaggaggtgcagatcacccaggtccac
agccacgagggctcaggccagttcacactgcctggagcctcgtgcttgcagggtgaaggc
aagggccaccaaagccggaagaagatggtgaccattcctgcaggcagcatccttgcattc
cgagtggcccagctgctcattggctctgaatgggatattcttctcatctcaaatgagaaa
aagaggacctttgagctgccctcctcaggccacaaaggagcagtgggccagaggcggcat
gactttagtctgcttgccgtactccattccatcggggagcggctgagtctcaagtcagat
ggaaccaatgaggaagaagtaatcagggaagacttccaaggcctgcgtgcggaggtggag
gcaggctcttcagaactgcggagcttagaaatggagttgagacaacagctactagtagac
atcgggaggattttacaggaccagcccagcatggaagccttagaggcctcactagagcag
ggtctgtgcagtggtgagcaggtagagcctctggaaggcccagcaggcagcatccttgag
tgtctggtgctcgactctggagaactggtgccggaacttgcagcccccgtcttctacctg
ttgggagcactggctgggttgagtgaaacccagcagcagctactggctactaaggctctg
gaggcaacggtgctgtcaaaggagctagagttggtgaagcacgtcttggaacagagcacc
ccatggcaggagcagagatctgtgcccctgccctccaggctccttggggacagctgggat
gaggaggctctcacctgggtcttgctagaagaatgtggcctaacgctgcaggtggaaccc
ccccaggtatactgggaaccaacatctcagggccccatatgtgcactctatgcctccctg
gccctattgtcaagtctaggccagaaatcgtgttag

DBGET integrated database retrieval system