KEGG   Rattus norvegicus (rat): 315108Help
Entry
315108            CDS       T01003                                 

Gene name
Apol3
Definition
(RefSeq) apolipoprotein L, 3
  KO
K14480  apolipoprotein L
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    315108 (Apol3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ApoL DUF677 Chlorosome_CsmC MHCassoc_trimer
Motif
Other DBs
NCBI-GeneID: 315108
NCBI-ProteinID: NP_001264288
RGD: 1306480
Ensembl: ENSRNOG00000042771
UniProt: Q5U1W1
Position
7q34
AA seq 336 aa AA seqDB search
MAARVLRKQFIQDVTEYLQDTVSKKDLQLLLTKDEAWKVFVAEAELSRDEEASLHEALKL
LLKLPTWEDKVRLQKELQDRKKFVEAFPQLKRKLQENIRKLRALADHLDQVHKGCTISNV
VTNSTSAASGVLSILGLALAPVTAGGSLLLSATGLGLGTVATVTGAATEIVEQTNKWLDE
AEARRLLSDTMDTLNTALVLGQKALKLSKKAYDVIKQLKSLGQHIRAIRVARANPRLLAD
AKRLMTSGRLSAPRASQVQNAFEGTALAMTKKARIRGVATAGVFLAMDVYFLVRDSMDLC
DGAKSESGNKLRALAQELEEKLKEVAQIYKSLLVPY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggccgccagagtcttgaggaaacaattcattcaggatgtcactgagtatctacaggac
acggtcagcaaaaaagacctgcagctcctgttgaccaaagacgaagcctggaaagtgttc
gtggcagaggctgaattgtccagagatgaggaagcttcactgcatgaggctctgaagctg
ctcctgaaactccccacctgggaggacaaagtcagacttcaaaaggaactgcaggacagg
aagaagtttgtggaagcttttcctcagttgaaaaggaagctgcaggaaaacatcaggaag
ctccgagctctggccgaccatcttgaccaggtgcacaagggctgcaccatctccaatgtg
gtaaccaactccaccagcgctgcctcaggtgtcctgagcatcctgggtctggctctggca
cccgtgacagcagggggtagtctactgctctctgcaactggcctggggctggggacagta
gccactgtgaccggagctgccactgagattgtggagcaaacaaacaagtggttggatgag
gctgaggccaggcgcctgttgtcagacaccatggacactctaaacacagctcttgtcctg
ggtcagaaagcactcaaacttagtaaaaaagcctatgatgtcatcaaacaattgaaaagc
ttgggacagcacattcgtgccattagggtagccagagccaaccctcgcttacttgcagat
gccaagcgcctcatgacttctggaagactctctgccccacgtgctagtcaggtgcagaac
gcctttgaaggcactgctctagcaatgaccaaaaaagccagaatcaggggtgtagccact
gcaggtgtcttccttgccatggatgtgtatttccttgtgagggactcgatggatttatgt
gatggcgcaaaatcagagtcaggcaataaactgcgggccctggctcaggagctcgaggag
aagttgaaagaggttgctcagatctacaagagcctcctggtgccttactga

DBGET integrated database retrieval system