KEGG   Rattus norvegicus (rat): 315120Help
Entry
315120            CDS       T01003                                 

Gene name
Card10
Definition
(RefSeq) caspase recruitment domain family, member 10
  KO
K20912  caspase recruitment domain-containing protein 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    315120 (Card10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2 BLYB Mit_KHE1
Motif
Other DBs
NCBI-GeneID: 315120
NCBI-ProteinID: NP_001124026
RGD: 1304949
Ensembl: ENSRNOG00000008401
UniProt: D4A425
Position
7q34
AA seq 1021 aa AA seqDB search
MQGRADAAEADEEAGAGSGSEAEEDALWERIEGVRHRLTRALNPAKLTPYLRQCRVLDEQ
DEEEVLSTYRFPCRANRTGRLIDILRCRGKRGFEAFLEALEFYYPEHFTLLTGQEPAQRC
SMILDEEGPEGLTQFLMTEVRRLREARKSQLHREQQLQARGRALEEERAGLEQRLREQQA
AQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLK
VSRLEEECALLRRGRGPPPGAEEKEKEPDGVDLLSELRAENQRLTASLQELQEGLQQEMS
RPGAAGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDKYLQEMEDLRLK
HRTLLKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYRKQVRGL
EAERDELLTTVTSLEGTKAMLEAQLQRTQGGSSLKACASSHSLCSNLSSTWSLSEFPSPL
GGPEATGETGGSEPHTSEEATDSEKEINRLSILPFPPSAGSILRRQREEDPEPPKRSFSS
MSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGWSPSG
GLDPQDKSPDSLPILGDRWSGAVVRRVLSGPGSARTEQKEPRAEGSGLEGTGLEAEVQQR
TLPWNQSSTLPFLLDSKACQSFHEALDVWAKGPGAEPFYIRANFSLPERADPHALCVKAQ
EILRLVDPAYKRRQEWFCTRVDTLTLRDLDRGTVPNYQRAQQLLEVQEKYLISSRHRSPR
SNLKKRALGLVRPKPAGGTAGDSAEQLPADPCSELERSLKPYSLVRPLLVSALRPVVLLP
ECLAPRLIRNLLDLPSSRLDFQVCSAESLSGEEQCTSSAPGAPKAWPASAGLGSRIRAIQ
ESVGKKHCLLELGARGVRELVHSEVYPIVIHVEVTEKNVREIRSLLGRPGWRDSELLRQC
RGSEQWLWGLPCSWVQVPAHAWGHAEELAKVVRGRILQEQARLVWVERGSSRGGSGSSSE
A
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgcagggccgggcggacgcggccgaggccgacgaggaggctggggcgggctccgggtcg
gaggccgaagaggacgcgctatgggagcggatcgagggcgtccggcaccggctgacccgc
gccctgaacccggccaagctcacgccttatctgcgccagtgccgcgtcttggacgagcaa
gacgaggaggaggtgctcagcacctaccgttttccgtgccgcgctaaccgtaccgggcgt
ctcatagacattttacgctgccggggcaagaggggcttcgaggccttcctggaagcgctg
gaattctactacccagaacacttcacgctgctcactggccaggaacctgcccagcgctgc
tccatgatacttgatgaggaggggccagagggcctgactcagttcttgatgactgaagtc
cggaggcttcgggaagctcgaaagagccagctgcaccgagaacagcaactgcaggcccgg
ggccgggcactggaggaggagcgggcagggttagagcagcggcttcgggagcagcaggcg
gcacaggaacgctgccagcggctgagggaggactgggaggcgggcagcctggagctgctg
cgcctcaaggatgagaactacatgattgccatgcgcctggctcagctcagcgaggagaag
aactcggctgtgctgcgtagccgagacctgcagcttgcggtagatcagctcaagctcaaa
gtcagccgattggaggaagagtgtgcgctactgaggaggggcaggggcccaccgcctggg
gctgaagagaaggagaaggagccagacggtgtggatcttctctcagagcttcgggcagag
aaccagcgactgacagcttcactgcaggagctccaggaaggtcttcagcaggaaatgagc
cggccaggagctgcaggctctgaacgcattctgctggacatcctggagcatgactggagg
gaggcacaggacagcaggcaggagctgtgtcagaagcttcacgctgtgcagggcgagcta
cagtgggcagaagaactgcgggacaagtacctgcaggagatggaggatctgaggctcaaa
catcgaacgctgctgaaggactgtgacctctataagcaccgcatggccactgtgttggcc
cagctggaggagattgagaaagagcgggaccaggcaatccagagccgagaccggatccag
ttgcagtactctcagagcctcattgagaaggatcagtaccgcaagcaggtgcggggacta
gaggcggaacgcgatgagctgctcaccacagtcaccagcctggaggggaccaaggccatg
ctggaggcacagctacagcggacacaggggggttccagtctcaaggcttgtgcctcctcc
cactccctgtgctccaacctcagcagcacctggagcctcagcgagttcccatcaccactg
ggaggcccagaagctacaggagaaaccgggggatctgagccccacacctcggaggaagcc
acagacagtgagaaggagatcaaccggctctctatcctgccctttccacccagtgctggc
tccatactccgccggcagcgtgaggaagacccggagccccctaagaggtcttttagcagc
atgtcggatatcacagggagtgtgacccttaagccctggtcgcccggcctctcttcatca
tcgtcatctgacagtgtgtggcctttgggaaagccggaaggcctcctggcccggggttgt
ggcctggacttcctcaataggtctctggccatccgagtgtccggctggagtccctctggg
ggcctggacccccaggataagagtccagatagcctgccgatccttggggacagatggtct
ggggcagtggtgcgaagggtgttgtcggggcctggttccgccaggacagaacagaaagag
ccaagggcagaaggcagtggcctggaggggacaggcctggaagctgaggtccagcagagg
actttaccttggaaccagagctccaccctccccttcctgctggactcaaaggcctgtcag
tccttccatgaggccttggatgtctgggcaaaagggccaggtgcagaacccttctacatt
cgagccaacttctccttgcctgagcgggcagatccgcatgccctctgtgtgaaagcccaa
gagatcctgcggttggtggacccagcctacaagcggaggcaggagtggttctgcactcga
gtggacacccttaccttacgggacctggaccggggcactgtgcccaattatcagagagct
cagcaacttctagaagtccaggaaaaatacctgatctccagcagacaccgaagtcctcga
agcaatctgaagaagcgagccctggggctggtgaggcccaagcctgcagggggcactgca
ggagactcagcggaacagctacctgcagacccctgctcagagctagagcgaagcctaaaa
ccctacagcctggtgcggccactgttggtgtctgctctgaggcctgtggtgctcctgcct
gagtgcctggcacctcgccttatccgcaatctgctggatctgcccagctccaggctggat
ttccaagtgtgctctgcggaaagtctctctggagaggagcagtgtacatcctcggctccc
ggagcccccaaagcctggcctgccagtgctgggctgggtagcaggatccgtgccatccag
gagtctgttgggaagaagcactgtctgctggagctgggtgcacggggagtacgggagttg
gtgcacagcgaggtctaccccattgtcatccatgtggaggtgactgagaagaatgtccgt
gagatcaggagcctgttgggcaggccaggctggcgggattcagagctgctccgtcagtgc
cggggctcagaacagtggctctggggactgccgtgttcctgggtgcaggtgcctgcccat
gcgtggggccatgcagaggagctggccaaggtggttcgtggccgaatcttgcaggaacag
gctcgccttgtgtgggtggaacgaggcagcagcagagggggcagtggcagcagcagtgag
gcctga

DBGET integrated database retrieval system