KEGG   Rattus norvegicus (rat): 315137Help
Entry
315137            CDS       T01003                                 

Gene name
Apobec3b, Apobec3, Apobec3f
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3B
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    315137 (Apobec3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    315137 (Apobec3b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     315137 (Apobec3b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     315137 (Apobec3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N APOBEC3 SNAD4 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 dCMP_cyt_deam_1 Toxin-deaminase Viral_Rep
Motif
Other DBs
NCBI-GeneID: 315137
NCBI-ProteinID: NP_001028875
RGD: 1307800
Ensembl: ENSRNOG00000016852
UniProt: Q3T1K0
Position
7q34
AA seq 385 aa AA seqDB search
MGPVCLGCSHRRPYSPIRNPLKKLYQQTFYFHFKNVRYAWGRKNNFLCYEVNGMDCALPV
PLRQGVFRKQGHIHAELCFIYWFHDKVLRVLSPMEEFKVTWYMSWSPCSKCAEQVARFLA
AHRNLSLAIFSSRLYYYLRNPNYQQKLCRLIQEGVHVAAMDLPEFKKCWNKFVDNDGQPF
RPWMRLRINFSFYDCKLQEIFSRMNLLREDVFYLQFNNSHRVKPVQNRYYRRKSYLCYQL
ERANGQEPLKGYLLYKKGEQHVEILFLEKMRSMELSQVRITCYLTWSPCPNCARQLAAFK
KDHPDLILRIYTSRLYFYWRKKFQKGLCTLWRSGIHVDVMDLPQFADCWTNFVNPQRPFR
PWNELEKNSWRIQRRLRRIKESWGL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggaccagtgtgcctgggatgcagccatcgcagaccctattcaccgatcagaaacccg
ctaaagaagttatatcaacaaacattctactttcattttaagaacgtacgctatgcctgg
ggtcgaaagaataacttcttgtgctatgaagtgaatgggatggactgcgctttacctgtc
ccccttcgccaaggggtcttcaggaaacagggccacatccacgccgaactctgcttcata
tactggttccacgacaaagtcctgagagtgctgtccccgatggaagagttcaaggtcacg
tggtacatgtcctggagcccctgcagcaagtgcgcggagcaggtagccaggttcctggcc
gcacaccgcaacctaagcctggccatcttcagctcccgcttgtactactacttaaggaac
ccgaactaccagcagaagctctgcaggctgattcaggaaggagtccacgtggctgccatg
gacctaccagaatttaaaaagtgttggaacaagtttgtggacaatgacggccaaccattc
aggccttggatgagactgagaataaattttagtttctatgattgcaagcttcaggagatt
ttcagccgaatgaatctgctaagggaagatgtattttacttgcaatttaacaacagccac
cgggtcaagccagtccagaatcgctactatcgcaggaagtcctatctgtgctaccaactg
gagcgggccaatggccaagagccactcaaaggctacctgctatacaagaaaggtgaacag
catgtagaaatcctcttccttgagaagatgcggtccatggagctgagccaagtgcgaatt
acctgctacctcacctggagcccctgcccaaactgtgcccggcaactcgctgcattcaaa
aaggatcacccagacctaattctgcggatctatacctcccgcctgtatttctactggagg
aagaagttccagaaggggctgtgtactctgtggcgatcagggatccacgtggacgtcatg
gacctccctcagtttgctgactgctggacaaactttgtgaacccgcaaaggccctttagg
ccatggaatgaactggagaaaaacagctggcgcatacaaaggcggctccggaggatcaag
gagtcctggggcctgtaa

DBGET integrated database retrieval system