KEGG   Rattus norvegicus (rat): 315139Help
Entry
315139            CDS       T01003                                 

Gene name
Tab1, Map3k7ip1
Definition
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04668  TNF signaling pathway
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05161  Hepatitis B
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    315139 (Tab1)
   04064 NF-kappa B signaling pathway
    315139 (Tab1)
   04668 TNF signaling pathway
    315139 (Tab1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    315139 (Tab1)
   04621 NOD-like receptor signaling pathway
    315139 (Tab1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    315139 (Tab1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    315139 (Tab1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    315139 (Tab1)
   05161 Hepatitis B
    315139 (Tab1)
   05168 Herpes simplex virus 1 infection
    315139 (Tab1)
   05169 Epstein-Barr virus infection
    315139 (Tab1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    315139 (Tab1)
   05140 Leishmaniasis
    315139 (Tab1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C
Motif
Other DBs
NCBI-GeneID: 315139
NCBI-ProteinID: NP_001103446
RGD: 1306216
Ensembl: ENSRNOG00000017285
Vega: OTTRNOG00000002107
UniProt: A0A0U1RRU5
Position
7q34
AA seq 502 aa AA seqDB search
MAAQRRSLLQSEQQPSWTDDLPLCHFSGVGSASNRSYSADGKGTESHPPEDNWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNTEHTDADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLLPQYQKILERLKALEKEISGGAMAVVAVLLNNKLYV
ANVGTNRALLCRSTVDGLQVTQLNVDHTAENEDELFRLSQLGLDAGKIKQVGVICGQEST
RRIGDYKVKYGYTDIDLLSTAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEVAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAKFCPRHEDMTL
LVRNFGYPLGEMSQPTPTPAPGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGSH
SASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYV
DFAEFYRLWSVDHGEQSVMTAP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcctgctccagagtgagcagcagccaagctggacagatgac
ctgccactctgtcacttctccggcgttggttcagcttccaaccgtagctactctgctgat
ggcaagggcactgagagtcaccctccggaggacaactggctcaagttcagaagtgaaaac
aactgcttcctgtatggggtcttcaatggctatgatggcaaccgcgtgaccaactttgtg
gcgcagagactctctgcagagctcctgctgggccagctcaacaccgaacacacagatgct
gatgtgcgacgggtcctgctgcaggccttcgatgtggtggagaggagcttcctggagtct
atcgatgatgccttggctgagaaagcaagcctccagtcccagctgccggagggtgtgccc
caacaccagctgctacctcagtatcagaagatcctggagagactcaaggcactggagaag
gagatctcgggaggggccatggctgttgtggcggtccttctcaacaacaagctctacgtt
gccaatgttggtacgaacagggcccttctgtgcagatccaccgtggacgggctacaggtc
acacagctgaacgtggaccacaccgccgagaatgaggacgagctcttccgtctctcacaa
ctgggtttagacgcagggaagatcaagcaggtgggcgtcatctgtggacaggagagcacc
aggcgaattggggattacaaggtcaaatatggctacactgacattgacctgctcagcact
gccaaatccaaacccatcatcgcagagcccgaaatccacggcgcacagcctctggatggc
gtgacgggcttcctggtactgatgtcggaggggctgtacaaggccctggaggcagcccat
gggcctgggcaggccaaccaggaggttgccgcaatgattgacaccgaatttgccaagcag
acctccctcgatgcagttgcccaggctgtggtagaccgtgtaaagcgtatccacagtgac
acctttgccagcggtggggagcgggccaagttctgcccacggcatgaagacatgaccctg
ctggtgaggaactttggctatccattaggtgaaatgagccagccgacacccaccccggcc
ccagggggccgtgtgtaccctgtttctgtgccctactcaagtgcccagagcaccagcaag
accagtgtgactctgtccctcgtcatgccttctcagggccagatggtcaacggctctcac
agtgcctccaccttggatgaagccactcctactctcactaaccagagccccactctgacc
ctgcagtctaccaacacccacacccagagcagcagctccagctcggacgggggcctcttc
cgctccagaccggctcactcacttccacctggagaggatggcagggtcgagccctatgtg
gactttgctgagttttaccgactctggagcgtggaccatggcgagcagagtgtgatgacg
gcaccttag

DBGET integrated database retrieval system