KEGG   Rattus norvegicus (rat): 315141
Entry
315141            CDS       T01003                                 

Gene name
Mief1, Smcr7l
Definition
(RefSeq) mitochondrial elongation factor 1
  KO
K23507  mitochondrial dynamics protein MID51/49
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    315141 (Mief1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    315141 (Mief1)
SSDB
Motif
Pfam: Mab-21
Other DBs
NCBI-GeneID: 315141
NCBI-ProteinID: NP_001007710
RGD: 1359173
Ensembl: ENSRNOG00000017553
Vega: OTTRNOG00000002098
UniProt: Q5XIS8
Position
7q34
AA seq 463 aa
MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSP
TRLSHSGKRSWEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSAFDTDTFCPPRPKPLAR
RGQVDLKKSRLRMSLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMP
LRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNIPGFFLVRRENPEY
FPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEV
QYERDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCR
SLCLKILKAICKSTPALGHLTASQLTNVILHLSQEEADWSPDMLADRFLQALRGLISYLE
AGVLPSALNPKVNLFAELTPHEIDELGYTLYCSLSEPEVLLQT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcaggcgctggtgagcgcaaaggcaagaaggatgacaatggcattggaacggccatt
gattttgtgctctccaatgcccggctggtgctgggcgtgggtggagcagccatgctgggc
atcgccacattggcagttaagcggatgtacgaccgggcaattagtgcccctaccagcccc
acccgcctaagccattcaggaaagaggagctgggaggaaccaaactggatgggctctcct
cgactattgaacagggacatgaagacaggtctgagccggtccctgcagacccttcccaca
gactcttctgcctttgacacagatacattctgcccaccccggcccaaacctttggccagg
aggggccaggtagacttgaagaagtcacgactccgcatgtccctgcaggagaaacttctt
tcttactaccggaaccgtgcagccatccctgctggagagcaggctcgagccaagcaagct
gcggtggacatatgtgctgagctgcggagcttcctgcgggccaagctgcctgacatgcca
ctccgggacatgtacttgagtggcagcctctatgacgatctgcaggtggtgacagctgac
catatccaactcattgtccccctcgtgctggagcagaacctgtggtcgtgcatacctggg
gaggacaccatcatgaatatccctggtttcttcctggtccgtcgtgagaacccagagtac
tttcctcgtggtagcagttattgggaccgctgtgttgtaggtggctacctctccccaaag
acagtggcagacacctttgagaaggtggtggcaggctccatcaactggccagccataggg
tccctcttagactatgtgatccgaccagcaccacccccagaggccctgacactagaagtg
cagtatgagagggacaaacatcttgtcattgacttcctgccatcagtgacccttggtgac
actgtcttggtggccagaccacaccggttagctcagtatgacaacctgtggcggctgagc
cttcgtcctgctgagacggcacgcttacgggctttggaccaggcggactccggctgccgg
tctctgtgcctcaagatcctcaaggccatatgcaagtccactccagctctgggccacctc
actgccagccagctaaccaatgtcatcctccacttgtcccaggaggaggctgactggtct
ccagacatgttggccgaccgctttctacaggccctgaggggactcatcagctacttggag
gctggagtcttgcccagtgccctgaaccccaaggtgaacctatttgcagagctcacccct
cacgagatagatgaattggggtacaccctctactgctcgttgtctgagccggaggtgctg
ctgcagacgtag

DBGET integrated database retrieval system