KEGG   Rattus norvegicus (rat): 315150Help
Entry
315150            CDS       T01003                                 

Gene name
Adsl
Definition
(RefSeq) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00250  Alanine, aspartate and glutamate metabolism
rno01100  Metabolic pathways
Module
rno_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    315150 (Adsl)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    315150 (Adsl)
Enzymes [BR:rno01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     315150 (Adsl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 ADSL_C DUF4089 HTH_Tnp_Tc5 Wtap
Motif
Other DBs
NCBI-GeneID: 315150
NCBI-ProteinID: NP_001123975
RGD: 1307617
Ensembl: ENSRNOG00000018655
UniProt: D3ZW08
Position
7q34
AA seq 484 aa AA seqDB search
MAASGDPACAESYRSPLAARYASHEMCFLFSDRYKFQTWRQLWLWLAEAEQTLGLPITDE
QIQEMRSNLSNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTD
LIILRNAFDLLLPKLARVISRLADFAKERADLPTLGFTHFQPAQLTTVGKRCCLWIQDLC
MDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQLDKMVTEKAGFKRAYIITG
QTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMR
SERCCSLARHLMSLTMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILTTLQNVSE
GLVLYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAAAVVKQEGGD
NDLIERIRADAYFSPIHSQLEQLLDPSSFTGRAPQQVHRFLEEEVYPLLKPYGSVMAVKA
ELCL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatccggggaccctgcctgtgctgaaagctaccgttctccgctggcggctcgc
tacgccagccatgaaatgtgcttcttgttcagcgacaggtacaagttccagacgtggcgg
cagctgtggctgtggctggcggaggccgaacagacactgggtttgcctatcacggatgaa
cagatccaggagatgaggtcgaacctgagcaacattgacttccagatggcagctgaggaa
gagaagcgcctgcggcacgacgtgatggctcatgtgcacacgtttggccactgctgtccg
aaagctgctggcatcatccatcttggagccacctcctgctatgttggagacaatacggac
ttgattattctgagaaatgcatttgacctgcttttaccaaagcttgctagagtgatctcg
aggcttgccgactttgctaaggaacgtgctgatctgcccacattaggtttcacacacttt
cagcctgctcagctgaccacggttgggaaacgctgctgcctttggattcaagatctctgc
atggatcttcagaacttgaagcgtgtccgagatgagctgcgcttccgaggagtgaagggc
accactggcacgcaggccagcttcttgcagctcttcgagggggatcaccagaaggtggag
cagctggacaagatggtgacagaaaaggcagggtttaaaagagcttacatcatcacagga
cagacctacacacggaaagtggacatcgaagtgctgtctgtgctggccagcctaggggcg
tcagtgcacaagatttgcactgacattcgcctactggcgaacctgaaggagatggaggaa
ccctttgagaagcagcagattggttccagtgcgatgccgtacaagcggaaccccatgcgc
tccgaacgttgctgcagcttggctcgtcacctgatgtcccttaccatggacccactacag
acagcttctgtgcagtggtttgaacgtaccctggatgatagtgccaaccgacggatctgt
ttggctgaagcatttctcactgcagacactatattaactactctacagaacgtctctgaa
ggattggtgctgtaccccaaggtaattgaacggcgcattcggcaagagcttcctttcatg
gccacagagaacattatcatggcaatggtcaaagccgggggcagccgacaggactgtcat
gagaaaattagagtgctttcccagcaggcagctgctgtggttaagcaggaagggggtgac
aatgaccttatagagcgcattcgggcagatgcctacttcagccccattcactcacagttg
gaacaattgttggacccctcttctttcactggccgagctccccagcaggtccacagattc
ctagaagaggaggtgtaccccctgctgaagccctacggaagtgtgatggcagtgaaggcg
gagctgtgtctgtag

DBGET integrated database retrieval system