KEGG   Rattus norvegicus (rat): 315151
Entry
315151            CDS       T01003                                 

Gene name
Mkl1, BSAC, FLMKL1, MELODY, MKL1met, Mrtf-a
Definition
(RefSeq) megakaryoblastic leukemia (translocation) 1
  KO
K22525  MKL/myocardin-like protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    315151 (Mkl1)
SSDB
Motif
Pfam: RPEL SAP SAP_new25 DUF722
Other DBs
NCBI-GeneID: 315151
NCBI-ProteinID: XP_001077101
RGD: 1304873
Ensembl: ENSRNOG00000018803
UniProt: A0A0G2K3Y9
Position
7q34
AA seq 928 aa
MPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERSELVRMHILEETSAEPSLQAKQLK
LKRARLADDLNEKIAQRPGPMELVEKNILPVESSLKEALIVGQVNYPKVADSSSFDEDSS
DALSPEQPASHESQGSVPSPLESRASDLLPSATSISPTQVLSQLPMAPDPGETLFLAEQP
PLPPPPLLPPSLTSGSIVPTAKPAPTLIKQSQPKSASEKSQRSKKAKELKPKVKKLKYHQ
YIPPDQKQDKGAPAMDSSYAKILQQQQLFLQLQILNQQQQQQQQQHYNYQAILPAPPKPS
GETPGSSAPTPSRSLSTSSSSSSGTPGPGGLARQNSTALAGKPGALPANLDDMKVAELKQ
ELKLRSLPVSGTKTELIERLRAYQDQVSPAPGAPKAPATTSVLSKAGEVVVAFPAALLST
GSALVTAGLAPAEMVVATVTSNGMVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDAFG
EMVTSPLTQLTLQASPLQIVKEEGARAASCCLSPGARAELEGLDKDQMLQEKDKQIEELT
RMLQQKQQLVELLRLQLEQQKRAQQPAPASSPVKRESSFSSCQLSCQPQGAARAFGPGLV
VPTTNHGDAQAPAPESPPVVVKQEAGPPEPDLAPASQLLLGSQGTSFLKKVSPPTLVTDS
TGTHLILTVTNKSADGPGLPTGSPQQPLSQPGSPAPGPPAQMDLEHPPQPSFATPTSLLK
KEPPGYEETVTQQPKQQENGSSSQHMDDLFDILIQSGEISADFKEPPSLPGKEKSPPAEA
YGPPLTPQPSPLSELPQAAPPPGSPTLPGRLEDFLESSTGLPLLTSGHEGPEPLSLIDDL
HSQMLSSSAILDHPPSPMDTSELHFAPEPSSGMGLDLAVGHLDSMDWLELSSGGPVLSLA
PLSTTAPSLFSMDFLDGHDLQLHWDSCL
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgccgcctttgaaaagtccggctgcatttcatgagcagagaaggagcctggagcgggcc
aggaccgaggactatttgaaacggaagatccgttcccggccagagagatcagagctggtc
aggatgcacattctggaagagacctcggctgagccttctctccaggccaagcagctgaag
ctgaagagagccagactggccgatgacctcaatgagaagattgcacagaggcctggcccc
atggagctggtggaaaagaatatcttgccagtcgagtctagcctgaaggaggctctcatt
gtgggccaggtgaattacccaaaggtagcagacagttcctcctttgacgaggacagcagc
gatgccctgtctcctgagcagcctgccagccatgagtcccagggttcagtgccatcaccc
ttggagtcccgggccagcgatctacttcctagtgccacctccatatcacccactcaggtt
ctttctcagctcccaatggctccggatcctggagagacgcttttcctggcagagcagcct
cctctgcctcccccgcctctgctgccccccagcctaaccagtggaagcatcgtccccact
gccaagcccgcgcccacactcatcaagcaaagccaaccgaagtctgcgagcgagaagtca
cagcgcagcaagaaggccaaggagctgaagccaaaagtgaagaagctcaagtaccaccag
tacatccccccggaccaaaagcaggacaagggggcgcctgccatggactcttcctacgcc
aagatcctgcagcagcagcagctcttcttgcagctgcagatcctcaaccagcagcagcag
cagcagcagcagcagcattacaactaccaggccatcctgcccgcccctcccaagccctcg
ggtgagactcccggaagcagtgcccccaccccatcacgcagtctctccaccagtagcagc
tctagctcaggcaccccagggcccggtgggctggcccgtcagaacagcactgccctggct
ggcaaaccaggagccctgccggccaacctggatgacatgaaggtggcagagctgaagcag
gagctgaagttgcggtcgctgcccgtctcaggcaccaagacagagctgattgagcgcctg
cgtgcctaccaagaccaagtcagcccagctccaggagcccccaaggcccctgccaccacc
tctgtcctgtccaaggctggtgaggtagtggtcgccttccctgcggccctgctgagcaca
gggtcagctcttgtaacagcaggccttgcaccagctgagatggtggtggccacagtaacc
agcaatggcatggtgaagtttggcagcacaggctccacaccccccgtgtctcccacccct
tcagagcgctcactgctcagcacgggtgatgagaattccacacctggggatgcctttggt
gaaatggtgacatcgccgctgacacagctcaccctgcaggcctccccactacagatcgtg
aaggaggagggtgcccgtgctgcgtcctgctgtctgagccctggtgcacgggctgagctg
gagggactggacaaggaccagatgctgcaggagaaggacaagcagattgaggagctgacc
cgaatgctccaacagaagcagcagctggttgagctgctacggctacagctggagcagcag
aagcgggcccagcagccagccccagccagcagccctgtgaagcgggaaagtagtttctcc
agttgccagctgagctgccagccccagggcgctgcccgtgcctttggccctggcctagta
gttcccaccactaaccatggagatgctcaggctccagcccccgagtccccacctgtggtg
gtaaaacaggaagctgggccacctgagccagatctggcccctgcctctcagctgctcttg
ggctcgcagggcaccagcttcctcaagaaggtcagccctcctaccctggtcactgactct
acaggaactcacctcatcctcactgtgaccaacaagagtgcagatggccctggcctgccc
acggggagcccccaacagcccttgtcccagcctggttctccagcccctggtccacctgcc
cagatggacctggagcacccacctcagccttcatttgcaacccccacgtctctgctgaag
aaggagccgcctgggtatgaagagactgtgactcagcagcctaagcagcaggaaaatggc
tcctccagtcagcacatggatgatctgtttgatattcttattcagagtggagagatttca
gcagatttcaaagagccaccatccctaccaggcaaggaaaagtcacctccagcagaagca
tatgggcctccgttaacaccacaaccctcgcctttgagtgaactaccacaggctgctcct
ccaccaggttcccccacgctcccagggcgccttgaagacttcctggagagcagcacaggg
ctgcccctgctgacaagtgggcatgagggaccagaacccctttccctcattgatgacctc
cacagccagatgctgagcagctctgccatcctggaccatcccccatcccccatggacacc
tctgaattgcactttgctcctgagcccagcagtggtatgggcctggacctggctgttggc
cacctggacagcatggactggctggagctgtcatctggtggccctgtgctcagcctggct
cccctcagcaccacagcccccagcctcttctcgatggacttcctggatggccacgacttg
cagctccactgggattcctgcttgtag

DBGET integrated database retrieval system