KEGG   Rattus norvegicus (rat): 315159
Entry
315159            CDS       T01003                                 

Gene name
Tob2
Definition
(RefSeq) transducer of ERBB2, 2
  KO
K14443  protein Tob/BTG
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    315159 (Tob2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    315159 (Tob2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     315159 (Tob2)
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     315159 (Tob2)
SSDB
Motif
Pfam: BTG PAM2
Other DBs
NCBI-GeneID: 315159
NCBI-ProteinID: NP_001007147
RGD: 1359722
Ensembl: ENSRNOG00000050500
UniProt: Q5U4F2
Position
7q34
AA seq 346 aa
MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLRGSGFRCVHI
GEVVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLGDGEVG
GAQELDKEIKSSFNPDAQVFVPIGSQDSSLSSSPSPSFGQSPSPTFIPRSAQPITFTTAS
FAATKFGSTKMKKGGGASSGVSVSGSGAGGQQPPSQQPRLARSPTNNLLKHKSLSLSMHS
LNFITANPGPQSQLSPNAKEFVYNGGGSPSSLFFDGVDGPGTSAAAPFGSSGASTCNSSS
FDVAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPNQPFQPVVLAN
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgcagctggagatcaaagtggccctaaacttcatcatctcctacttatacaacaagctg
ccccgtcgcagggcagatctgttcggggaggagctagagcggcttttgaagaagaaatat
gaaggccactggtaccctgagaagccgctgaggggttccggcttccgctgcgtccacatt
ggggaagtcgtagaccctgtggtggagctggctgccaagcggagtggcctggcagtggag
gatgtgcgcgccaacgtgcccgaagagctgagtgtctggattgaccctttcgaggtatcc
taccagattggtgagaagggagctgtgaaggtcctgtacctgggggacggtgaggtgggc
ggtgcccaagagctggacaaggagatcaagagcagcttcaatcccgacgcccaggtgttt
gtgcccatcggcagccaggacagctccctgtccagctctccctcaccatcctttggccag
tcccccagccccaccttcatcccccggtctgcccagcccatcaccttcactactgcctcc
tttgctgccaccaagtttggttccaccaagatgaagaagggtggtggggcctcaagcggt
gtgagtgtgagcggcagcggggcaggcggccagcagccaccgtcccagcagcctcgcctg
gcccgctcccccacaaataacctgctgaagcacaagagcctctctttgtctatgcattca
ctgaacttcatcacagccaacccgggcccccagtcccagctctcccccaatgccaaggag
tttgtgtacaacggtggtggttcgcccagcagcctcttcttcgacggggtggatggcccg
ggcaccagtgctgccgccccctttgggagtagcggtgccagcacttgcaacagcagcagc
ttcgacgtggcccaggtgtttggaggtggtgctaacagcctgttcctggagaaaacgccc
ttcgtagaaggcctcagctacaacctgaacaccatgcagtatcccaaccagcccttccag
cctgtcgtgctggccaactga

DBGET integrated database retrieval system