KEGG   Rattus norvegicus (rat): 315165
Entry
315165            CDS       T01003                                 

Gene name
Naga
Definition
(RefSeq) alpha-N-acetylgalactosaminidase precursor
  KO
K01204  alpha-N-acetylgalactosaminidase [EC:3.2.1.49]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00603  Glycosphingolipid biosynthesis - globo and isoglobo series
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    315165 (Naga)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    315165 (Naga)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.49  alpha-N-acetylgalactosaminidase
     315165 (Naga)
SSDB
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase Melibiase_C
Other DBs
NCBI-GeneID: 315165
NCBI-ProteinID: NP_001012120
RGD: 1306025
Ensembl: ENSRNOG00000008064
UniProt: Q66H12
Position
7
AA seq 415 aa
MLQKTVLLLALVAQVLMLENGLLRTPPMGWLAWERFRCNINCEEDPKNCISERLFMEMAD
RLAQDGWRDLGYVYLNIDDCWIGGRDATGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYE
DMGKMTCMGYPGTTLDKVELDAATFAEWKVDMLKLDGCYSTPKERAEGYPKMAAALNATG
RPIAFSCSWPAYEGGLPPKVNYTEVAGTCNLWRNYKDIQDSWKSVLSILDWFVKHQDILQ
PVSGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLFMSTDLRTISPQNIDILQNP
LLIKINQDPLGIQGRLIFKSKSHIEVFKRNLSDDASALVFFSRRTDMPYHFHCSLLELNY
PKGSVYEGQNVFTGDIISGLHPETNFTVIINPSGVVMWYLYPVKGLGIYTMMSQL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgttgcagaagacagtgctcttactggccctggtggctcaggtactgatgctggagaat
gggctactgcggacaccacccatgggctggctggcctgggaacgtttccgctgtaacatc
aactgtgaggaggacccgaagaactgcatcagtgagcgactctttatggagatggctgac
agattggctcaggatggatggcgggacctaggctatgtatacctcaacatcgatgactgc
tggattggtggacgtgatgccacaggccgcctgatacctgatcccaagcgattccctcac
gggattgccttcctggctgactatgctcattctttgggtctgaagctaggcatctatgag
gacatgggcaaaatgacctgcatgggttaccctggcaccactctagacaaagtggagcta
gacgctgcaaccttcgcagagtggaaggtggacatgctgaaactggatggctgttactcc
actcccaaggagcgtgcagaggggtaccccaagatggctgctgccctgaatgccacaggc
cgtcccatcgccttttcttgcagctggccagcctatgaagggggcctaccccccaaggtg
aactacactgaggtcgccggcacctgcaatctctggcgcaactataaagacatccaggac
tcctggaagagtgtgctgtccattctggactggtttgtgaaacaccaggacatactgcag
cccgtgtcgggtcctgggcactggaatgacccagatatgctgctcatcgggaacttcggc
ctcagcttcgatgaatcccgggcccagatggccctgtggacagtgctggcagcccccctc
ttcatgtccacggacctgcgtaccatctccccccagaatatagacattcttcagaatcca
ctcctgatcaaaatcaatcaggaccccttaggcatccagggacgcttgatcttcaagagc
aaatcccacatcgaagtgttcaagcggaatctgtctgacgatgccagtgccctggtcttc
ttcagccgcaggacagacatgccttaccacttccattgttccctcttggaactgaactac
cccaaaggcagtgtgtatgagggccagaacgtcttcacaggagacatcatcagcgggctc
caccctgaaaccaacttcactgtgatcatcaacccttccggggttgtgatgtggtaccta
tatcccgtcaagggcttggggatatacacaatgatgtcccagttgtga

DBGET integrated database retrieval system