KEGG   Rattus norvegicus (rat): 315174Help
Entry
315174            CDS       T01003                                 

Gene name
Scube1
Definition
(RefSeq) signal peptide, CUB domain and EGF like domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FXa_inhibition cEGF Ephrin_rec_like EGF_CA EGF_3 CUB EGF hEGF
Motif
Other DBs
NCBI-GeneID: 315174
NCBI-ProteinID: NP_001128356
RGD: 1309015
Ensembl: ENSRNOG00000010617
UniProt: F1M987
Position
7q34
AA seq 1018 aa AA seqDB search
MGAAAVRWHLCLLLALGARGQLVGGSGLPGAVDVDECSEGTDDCHIDAICQNTPKSYKCL
CKPGYKGEGKQCEDIDECENDYYNGGCVHDCINIPGNYRCTCFDGFMLAHDGHNCLDVDE
CQDNNGGCQQICVNAMGSYECQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRET
PKGGVACDCRPGFDLAQNQKDCTLTCNYGNGGCQHSCEDTDTGPMCGCHQKYALHADGRT
CIEKDEAAIERSQFNATSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVG
FTLQPDGKTCKDINECLMNNGGCDHFCRNTVGSFECGCQKGHKLLTDERTCQDIDECSFE
RTCDHICINSPGSFQCLCHRGYILYGTTHCGDVDECSMNNGSCDQGCVNTKGSYECVCPP
GRRLHWNRKDCVEMSGCLSRSKASAQAQLSCGKVGGVENCFLSCLGQSLFMPDSETSYIL
SCGVPGLQGKAPPKRNGTSSSVGPGCSDAPTTPIRQKARFKIRDAKCHLRPRSQERAKDT
LRHPLLDNCHVTFVTLKCDSSKKRRRGRKSPSKEVSHITAEFEVEMKVEEASGSCEADCM
RKRAEQSLQAAIKTLRKSIGRHQFYVQVSGTEYEVAQRPAKAPEGTGTCGIGQILQDGKC
VPCAPGTYFSSEPGQCVPCVSGTYQDMEGQLSCTPCPSSEGLGLAGARNVSECGGQCSPG
FFSEDGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKQTGTASFQECEAKVHCSPGHHYN
TTTHRCIRCPVGTYQPEFGQNHCISCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIE
SPNYPGDYPANAECVWHIAPPPKRRILIVVPEIFLPIEDECGDVLVMRKSASPTSVTTYE
TCQTYERPIAFTSRSRKLWIQFKSNEANSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYAS
ENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcggccgtgcgctggcacttgtgcctgctgctcgctctgggagcgcgaggg
cagctggtggggggcagcgggctgccaggagccgtggatgtggatgagtgctcagagggc
acagatgactgccacatagatgccatctgtcagaacacacccaagtcttacaaatgtctc
tgcaagccgggctacaagggggaagggaagcagtgcgaagacatcgatgagtgtgagaat
gactactacaacgggggctgtgtccatgactgcatcaacatccctgggaactacaggtgc
acctgctttgacggcttcatgctggcccacgatggacacaactgtctggatgtagatgag
tgccaagacaacaacggtggctgccagcagatctgtgtcaatgccatgggcagctatgag
tgccagtgccacagcggcttttttctcagtgacaaccaacacacctgcatacaccgctcc
aacgagggtatgaactgcatgaacaaagaccatggctgtgcccacatctgccgggagacg
cccaaaggtggggtagcctgtgactgcaggcccggctttgaccttgcccaaaaccagaag
gactgcacactaacctgtaactatggaaacggaggctgtcagcacagctgcgaggacacg
gacacgggccccatgtgtggctgccaccagaagtacgccctacacgccgatggtcggacg
tgcatcgagaaggatgaggctgcaattgagcgctctcagttcaatgccacgtcagtagct
gatgtggacaagcgtgtgaaacggcggctcctcatggagacgtgtgcggtgaacaacgga
ggctgtgaccggacgtgtaaggacactgccaccggcgtgagatgcagctgcccagttgga
ttcacgctacagccggatggaaagacatgcaaagacatcaacgagtgcttgatgaacaac
ggaggctgcgaccacttctgccgaaacactgtgggcagctttgaatgcggctgccaaaag
ggccacaagctactgacggacgagcggacatgccaagacattgacgagtgttcctttgag
cggacctgtgaccacatctgcatcaactcccccggcagcttccagtgcctgtgtcaccga
ggctacatactctacgggacaacccactgcggagacgtggatgagtgcagcatgaacaac
ggcagctgtgatcagggctgcgtcaacaccaagggcagctacgagtgtgtgtgcccacca
gggaggaggctgcactggaatcggaaggactgtgtggagatgagcgggtgcctgtctcgg
tccaaggcctctgcccaggcccagctgtcctgtggcaaggtgggtggagtggaaaactgc
ttcctgtcctgcctgggccagagtctcttcatgccagactcagaaaccagctacatcctg
agctgtggtgttccaggtctccagggcaaggcaccaccgaagcgcaatggcaccagctcc
agtgtggggcccggctgctcagatgcccccaccacccccatcagacagaaggcccgcttc
aagatcagagatgccaagtgccacctgcggccccgcagccaggagcgagcgaaggatacc
ctgaggcatccccttttagacaactgccacgtgactttcgtgaccctcaagtgcgactcc
tccaagaagaggcgtcgaggccgcaagtccccctccaaggaggtgtcccacatcacggca
gagtttgaggtagagatgaaggtggaagaggcctcaggctcctgcgaagcagactgcatg
cggaagcgtgccgagcagagcctgcaggctgccatcaagactctgcggaagtccatcggc
cggcaccagttctacgtccaggtctccggcactgagtacgaggtggcccagcggccagcc
aaggcaccggaggggaccgggacatgtggcataggccaaatactacaggatggcaagtgt
gtaccatgtgctcctggcacctacttcagtagtgagccaggccaatgcgtgccgtgtgtg
tcgggaacctaccaggacatggaaggccagctcagctgcacgccgtgccccagcagcgaa
gggctgggtctggctggtgcccgcaacgtatccgaatgtggaggccagtgttctccaggc
ttcttctcagaggatgggttcaagccttgtcaggcctgccctgtgggcacataccagcct
gagcctgggcgtaccggctgcttcccctgtggaggtgggctgctcaccaagcagacgggt
actgcctctttccaggaatgtgaggccaaagtacactgctctcccggccaccactacaat
accactacccaccggtgcatccgatgtcctgtgggtacctatcaacccgagtttggccag
aaccattgcatctcctgtccgggcaacaccagcaccgattttgatggttccaccaatgtc
acacactgcaaaaaccagcactgcggtggcgagcttggtgactacacaggctatatcgag
tcccccaactaccctggagactacccagccaatgcggagtgtgtgtggcacattgcgcct
ccccccaagcgcaggatcctcattgtggtccctgagatcttcctgcccatcgaggatgag
tgtggcgatgttctggtcatgaggaagagcgcctcgcccacgtcagtcaccacctatgag
acgtgccagacctacgagcggcctatcgccttcacctcccgctcccgcaaactctggatc
cagttcaaatccaacgaggccaacagtggcaaagggtttcaagtgccctacgtcacctat
gacgaggactaccagcagctaatagaagacatcgtgcgcgatgggcgcttgtatgcctcg
gagaaccatcaggagattttgaaagacaagaagctgatcaaggccctctttgatgtgttg
gcacacccacaaaactacttcaaatacacagcccaggagtcaaaggagatgttcccccgg
tcctttatcaaacttctgcgttccaaagtgtctcggttcctgcggccctacaaataa

DBGET integrated database retrieval system