KEGG   Rattus norvegicus (rat): 315212Help
Entry
315212            CDS       T01003                                 

Gene name
Alg12
Definition
(RefSeq) ALG12, alpha-1,6-mannosyltransferase
  KO
K03847  alpha-1,6-mannosyltransferase [EC:2.4.1.260]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno00513  Various types of N-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    315212 (Alg12)
   00513 Various types of N-glycan biosynthesis
    315212 (Alg12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    315212 (Alg12)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.260  dolichyl-P-Man:Man7GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase
     315212 (Alg12)
Glycosyltransferases [BR:rno01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   315212 (Alg12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_22
Motif
Other DBs
NCBI-GeneID: 315212
NCBI-ProteinID: NP_001101574
RGD: 1304826
Ensembl: ENSRNOG00000004591
UniProt: B1WBY3
Position
7q34
AA seq 488 aa AA seqDB search
MAGKKSSGRQSLLPLGLLVTVAAIHLVACPYTKVEESFNLQATHDLLYHQLDIDKYDHHE
FPGVVPRTFLGPLLIAAFSSPVVYVLSLLEVSRFYSQLIVRGVLGLGVIFGLWTLQKAVR
QQFGATVAVMFCWISATQFHLMFYCTRTLPNVLALAVVLPALTAWLQHRWAVFVWLSAFV
IIGFRAELAMLLGIMLLLTLYQRRMSVARLLQHAIPAGILCLGLTVAVDSYFWRYLVWPE
GVVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIPLGAVDRRTFALALPSLGFV
ALYSLLPHKELRFIIYTFPVLNIMAARGCTYVLNKKSWPYKVRALLVFGHVVVNVASTAT
SLYVSHFNYPGGVAMQRLHELVPPQTDVLVHIDVAAAQTGVSRFLQVNDDWRYDKREDVQ
LGAAGMLDYTHIIMEAVPGHLALYRDTHRVLARIEATTGVSLNLMKVPPFDVSLQTKLVL
LERLLRPA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaagaaatcatcaggcaggcagtcactgctgcctctggggctgttggtcact
gtagctgccatccaccttgttgcctgtccgtacaccaaggtagaagagagcttcaacctg
caggctacgcatgaccttctgtatcaccagctggacatagacaagtatgaccaccatgag
tttcctggagtcgttcccaggacattcctggggccgctgttgattgccgcgttctccagc
cctgtggtttatgtgctttcactgttggaagtctccagattttattctcagctgatagtc
agaggcgtccttggacttggtgtgatttttggactctggacattacagaaggcagtaaga
cagcagttcggggctacggtggctgtcatgttctgctggatatcagccacacagtttcat
ctcatgttctactgtacgaggacgcttcccaacgtgttggccctggctgtggttttaccg
gccctcacagcctggctgcagcacagatgggccgtctttgtctggctctccgcctttgtc
atcattggcttcagggctgagctggctatgctgctgggcatcatgctgctgctgaccttg
taccaaaggaggatgtctgtggccagattgctccagcacgccatcccagcagggattctt
tgcctagggctgacggttgctgtggactcctatttctggcgataccttgtgtggccagaa
ggagtggtgctttggtacaacactgtcctgaacaaaagttccaactggggtacctcccca
ctcctgtggtatttctactcagccctgccccgaggcctgggctgcagccttctcttcata
cccctgggtgcagtggacaggagaacctttgcgttggctctgccaagccttggattcgtg
gctttatactcgctcctcccacacaaggaactgcggttcatcatctataccttccctgta
ctcaacatcatggctgccagaggctgcacctatgtcctgaataaaaagtcttggccgtac
aaggtgagagctctgctggtgtttggacatgtcgtggtaaatgtggcgtctacagccaca
tccctctatgtgtcccatttcaactaccctggtggggttgcgatgcagcggctacatgaa
ctggtgccacctcagacagatgtccttgtacacatcgatgtggctgctgcccagacaggc
gtgtcacggtttctacaggtcaacgatgactggaggtatgacaagagggaagatgtgcag
ctgggagcagcgggcatgctggactacacccacatcatcatggaggcagtgcctgggcac
ctggccctctacagggacacgcaccgagtcctagcccggattgaggccactacaggtgtg
agcctgaatctaatgaaagtgccgccctttgatgtcagcctgcagacaaagctggtactt
ctagagcggctgcttaggccggcctga

DBGET integrated database retrieval system