KEGG   Rattus norvegicus (rat): 315219Help
Entry
315219            CDS       T01003                                 

Gene name
Tymp, Ecgf1
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    315219 (Tymp)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    315219 (Tymp)
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    315219 (Tymp)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     315219 (Tymp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-GeneID: 315219
NCBI-ProteinID: NP_001012122
RGD: 1305756
Ensembl: ENSRNOG00000032394
UniProt: Q5FVR2
Position
7q34
AA seq 476 aa AA seqDB search
MAAPGTPPPLAPETAGADSGGGSGEHRQLPELIRLKRNGGHLSEADIRNFVHALMDGRAQ
DTQIGAMLMAIRLQGMDLEETSVLTQALAESGQQLEWPKAWHQQLVDKHSTGGVGDKVSL
VLAPALAACGCKVPMISGRSLGHTGGTLDKLESIPGFSVTQSPEQMLQILEEVGCCIVGQ
SEKLVPADGILYAARDVTATVDSVPLITASILSKKAVEGLSTLVVDVKFGGAAVFPDQEK
ARELAKMLVRVGMGLGLQVAAALTAMDNPLGRNVGHTLEVEEALLCLDGAGPPDLRDLVI
RLGGAILWLSGQAETQDQGAARVAAALDDGSALHRFQLMLSAQGVDPGLARALCSGSPTQ
RRQLLPHARKQEELLSPADGIVECVRALPLACVLHELGAGRSRAGQPIRPGVGAELLVDV
GQWLSRGTPWLRVHLDGPALSSQQRRTLLGALVLSDRAPFKAPSPFAELVLPPTTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccagggacaccacctcccttggccccagagacagctggtgccgactcgggg
ggagggagtggggagcacaggcagctgccagagctgatccgcctcaagcgaaatggaggg
catctgagcgaagcagatatcagaaacttcgtgcacgcgttgatggacggaagagcacag
gacacacaaatcggggccatgctgatggccattcggctgcaaggcatggacctagaggag
acatctgtgttgactcaggccctcgcagagtctgggcagcaactggagtggcccaaggcc
tggcaccagcagcttgtggacaaacactccacaggaggtgtgggcgataaggttagcctg
gttctggcacctgccctggctgcatgtggctgcaaggtaccaatgatcagcggacgcagt
ttgggacacacagggggcacgctggataaactggaatctattcctgggttcagcgtcacc
cagagcccagaacagatgctgcagatacttgaggaagtcggctgctgcattgttggccag
agtgaaaagctagttcctgctgatggaatcctgtatgctgcacgagatgtgacagctact
gtggacagtgtaccgctcattacagcgtcaatcctcagtaagaaagccgtggagggactg
tccactctggtggtagatgttaagtttgggggggctgcagtcttcccagaccaggagaag
gcccgagaactggcaaagatgttggttagagtgggaatgggtctggggctgcaggttgct
gcagccctgaccgccatggacaaccctctgggccgcaacgtgggtcataccctggaagtg
gaagaagcgttgctttgcctggatggtgcggggccgccggatctgcgggacctggtcatt
aggctaggaggcgccattctttggcttagcggacaggcagaaacccaagaccagggtgcc
gcccgagtggccgcggcgttggatgatggctctgcgctgcaccgcttccagctgatgctt
tcggcgcagggcgtagaccccggcctagctagagcattgtgctccggaagccccacgcaa
cgccggcagttgctgcctcacgcccgaaagcaagaagagctgctctcaccggcagacggc
attgtggagtgcgtccgagcgctgccgctggcctgtgtactgcacgagctcggagccgga
cgcagccgagcagggcagccgatcagaccgggagtgggtgccgaactactggtcgacgtg
ggccaatggttgtcccgcgggacaccctggctccgcgtgcacctggacggccccgcgctc
agcagtcagcagcgccgcactcttctgggggctctcgtgctgtcagatcgagcacccttc
aaggccccttcacccttcgctgagcttgtcctcccaccgaccaccccatag

DBGET integrated database retrieval system