KEGG   Rattus norvegicus (rat): 315220Help
Entry
315220            CDS       T01003                                 

Gene name
Mapk8ip2
Definition
(RefSeq) mitogen-activated protein kinase 8 interacting protein 2
  KO
K04435  mitogen-activated protein kinase 8 interacting protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    315220 (Mapk8ip2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    315220 (Mapk8ip2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    315220 (Mapk8ip2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH3_9 SH3_1 SH3_2 PID_2 BSP_II
Motif
Other DBs
NCBI-GeneID: 315220
NCBI-ProteinID: XP_001055248
RGD: 1309727
Ensembl: ENSRNOG00000032828
UniProt: G3V9M2
Position
7q34
AA seq 835 aa AA seqDB search
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
SLGRSEQPHPICSFQDDFQEFEMIDDNEEEEDEEEEEEEEEEEDGDGDGRAGGGSGSQEL
SGESLIPSPSIEESHKLRPTTLHLTTLGAQDSLNNNSNGGFTSAPPSSWQETVLRSPVQE
PLKELPAPLLPAEEEHHEVQSLARPGCDCEGNQPPEPPASGGASPSSDPGIEADLRSHSS
GGHEGRRSSQELSSPGSDSEEAGGARLGRMISSISETELELSSDSGSSSGRSSHLTNSIE
EASSPASEPEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSPWLLS
NLVSRMISEGSSPIRCPGQCLSPPAPRPPEEAASQANPVPQDCPDPEAVAGPHVELVDMD
TLCGPPPPAPAAPRLGPAQSGPCLFLSNPTRDTITPLWAPPGRTARPGRSCSAACSEEEE
EDEEEDEEDEEDAEDSVIPPGSRTTGSTAPLDASLVYDAVKYTLVVDEHTQLELVSLRRC
AGLDNDSEEDSSCEASEEEAGATLLGSDQVPEDASPDSPDLTFSKKFLNVFVNSTSRSSS
TESFGLFSCVVNGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRT
GERGVFPAFYAHAVPGPAKDLLGSKRSPCWVDRFDVQFLGSVEVPCHQGNGILCAAMQKI
ATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCY
FGFITKHPLLSRFACHVFVSQESMRPVARSVGRAFLEYYQEHLAFACPTEDIYLE
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcgcgcggagatgttttctctctcaacctttcactcgctgtcgcctccgggc
tgcaggcctccccaggacataagcctggaagaatttgatgatgaagacctatctgagatc
acggacgactgtggcctgggccttagctacgactccgaccactgcgagaaggacagtctc
tccctgggtcgctcagagcagccgcaccctatctgttccttccaagatgatttccaggag
tttgagatgatcgatgacaatgaggaagaggaagatgaggaggaggaggaagaggaggaa
gaggaggaagatggagacggggacggcagagcagggggaggatctggttcacaggaactt
tctggagaatcccttattccctctccttccatagaggagtcccacaagctccgacccacc
accctccacctgactacacttggagcccaggactccctcaacaacaacagcaatggaggc
tttacctctgcgcccccatcttcctggcaggaaacagtgctgcgttcaccagtccaggag
ccccttaaagagctaccagcccctctcttaccagcagaagaggagcaccatgaggtacag
tcccttgcacgccctggttgtgactgtgaagggaaccagccgccagagccaccagcatca
ggtggggcttccccttcctcggatcctggtatcgaggctgacttgagaagccactctagt
ggaggccatgaaggtcggcgaagcagccaggagctctcatcaccaggctcggactctgag
gaggcaggcggcgcacgcctagggcgcatgatctcttccatttctgagacggagctggag
ctgagcagtgacagtggcagcagcagcggccgctcctcacacctcaccaactctatcgag
gaggcttcgtccccagcctcagagcctgaacctgagcccgagcccgagccactacatgaa
cctccccgccgccctgccttcctgcctgtgggccaggacgacaccaacagcgagtatgag
tccggctctgagtctgagcctgatctgagtgaggatgctgactcgccctggctactcagc
aacctggtgagccgcatgatctccgagggctcctcgcctattcgttgccctggccagtgc
ttgtctcctcctgcaccacgcccgccagaagaggctgcatcccaggccaacccggtaccc
caggactgcccagaccctgaggcagtagcagggccccacgtggagttagtggacatggac
accctttgcgggccacctccgccggcccctgcagcacctcggcttggtccagcgcagtct
gggccctgccttttccttagtaacccaacacgtgataccatcaccccactttgggcccca
cctggacgcactgctcgccctggccgctcctgctctgctgcctgctcggaggaggaggag
gaggatgaggaagaggacgaggaggatgaggaggatgctgaggacagcgtgattccccct
ggctccaggactacaggctctactgcgccgctggatgcctcgctggtgtacgatgcggtt
aaatacacactagtggtggatgagcacacgcagctagagctggtgagcctgcggcgctgt
gcaggcctggacaacgacagtgaagaggacagcagctgcgaggccagtgaggaagaggcg
ggagctacgttactaggcagtgaccaggtgccagaagacgcctctcctgacagccccgac
ctcaccttctccaagaagttcctcaatgtctttgtcaacagcacatctcgatcttccagc
actgagtccttcggtcttttttcctgtgtggtcaatggagaagagagagagcagacacac
cgggctgtcttcaggttcatccctcgacatccagatgaactagagttagatgtggacgac
ccggtgttggtggaagccgaagaggacgacttttggttccgtggcttcaacatgcgcacc
ggcgagcgtggagtgttccctgccttctacgcccatgcagtacctggtcctgccaaggac
ctgctggggagcaagcggagcccttgctgggtggatcgcttcgatgtgcagttcttgggc
tctgtggaggtaccatgtcaccagggcaatggtatcttgtgtgcagccatgcaaaagatt
gccacagcccggaaactaacggtccacctgcgccctcctgcctcttgtgaccttgagatc
tctctgcggggggtcaagctgagtctgagtggaggaggacctgagttccagcgttgcagc
cactttttccagatgaagaacatctccttctgtggctgtcatccccgaaacagctgctat
tttggcttcattaccaaacacccgctgctaagccgctttgcctgccacgtctttgtgtcc
caggagtctatgaggccagtggcaaggagcgtgggccgggccttcctggagtactaccag
gagcacctggcattcgcctgccccacagaagatatctacctggagtag

DBGET integrated database retrieval system