KEGG   Rattus norvegicus (rat): 315272
Entry
315272            CDS       T01003                                 

Gene name
Ano6, Tmem16f
Definition
(RefSeq) anoctamin 6
  KO
K19500  anoctamin-6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    315272 (Ano6)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   315272 (Ano6)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer VEGFR-2_TMD
Other DBs
NCBI-GeneID: 315272
NCBI-ProteinID: NP_001101578
RGD: 1304765
Ensembl: ENSRNOG00000006995
UniProt: F1M5Z5
Position
7q35
AA seq 799 aa
MQMMTRNVLLNMELEEDDDEDGDIGDVPDSRRPFLAPHTPLPSGLVLENFDQTIVCSTFG
SLESQEDFRTPEFEEFNGKPDSLFFTDGQRRIDFVLVYEDESKKENNKKGTNEKQKRKRQ
AYESNLISHGLQLEATRSVSDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKTRSTF
DTFNWFTKVLRVNESVIKPEQEFFTAPFEKSRMNDFYILDRDSFFNPATRSRIVYFILSR
VKYQVMNNVNKFGINRLVSSGIYKAAFPLHDCKFNYKSEDPNCPSERYLLYREWAHPRSI
YKKQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCD
PDIGGQILMCPQCDRLCPFWRLNITCESSKEEERIPFTTCGKCIRITLCASAVFFWILLI
IASVIGIIVYRLSVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTI
YEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYW
LGKYRNEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWVMNLIGRYKRVSGSEKIT
PRWEQDYHLQPMGRLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKL
TTQFRRMVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSIPPYGD
HTYYTMDGYINNTLSVFNITDFKNTDKENPYIGLVRLSFTVLNQKICLLTCLVVLPGTVT
SETHPGTHKSINTTSTIGT
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgcagatgatgactaggaacgtcctgctgaacatggagctggaagaggacgacgatgag
gatggagacattggtgatgttcctgactccaggagaccttttctagctcctcatactcct
ctaccatccggtctggtgctggaaaacttcgaccagaccatagtctgctccacctttgga
tcactggagagccaggaggacttccgcactccagagtttgaagagtttaacggaaagcct
gactcgctctttttcaccgatggccagagacggatcgacttcgtcctcgtgtacgaagac
gagagcaagaaggagaacaataagaaagggacaaatgagaaacagaagaggaaaaggcaa
gcatacgaatctaacctcatcagccacggcctgcagctggaagccacaagatctgtttct
gatgacaagcttgtgttcgtcaaagtgcatgcgccctgggaagtgctgtgcacctatgct
gagatcatgcacatcaagctcccactaaagcccaatgacctgaagactcgttccaccttt
gacaccttcaactggttcaccaaggtcctccgtgtgaacgagagtgtcatcaagccggag
caggagttcttcactgccccctttgagaagagccggatgaatgacttctacatccttgac
agagactccttcttcaatcccgccaccagaagtcgcattgtttatttcatcctctctcgg
gtcaaataccaagtgatgaacaacgttaacaaatttgggattaatagactggtcagttct
ggcatctacaaagcagcgttccctctgcacgactgcaaattcaactataagtcggaagac
cccaactgtcctagcgagcgttacctcctgtacagggaatgggctcaccctcggagtata
tacaagaaacagcccttggatcttatcaggaagtattacggagagaagattggaatctac
ttcgcgtggctgggctattatacgcagatgctccttctagcagctgtggtgggcgtggcc
tgcttcctctatggatatcttaatcaggataactgcacttggagcaaagaggtctgtgat
cctgacatcggtggccagatcctgatgtgtccccagtgtgacaggttgtgtccgttctgg
aggctgaatatcacctgtgaatcctctaaggaggaggagcgtatcccatttaccacctgt
gggaagtgtatccggatcaccctgtgtgcgagcgctgtcttcttctggatcctgctcatc
atcgcctctgtgattgggatcattgtctacaggctgtccgtgttcatcgtgttctccacg
acgctccccaagaaccccaatgggacagacccaatccagaagtacctgaccccacagatg
gccacgtccatcacggcttccattattagtttcatcatcatcatgatcctcaacacgatc
tacgagaaggtggccatcatgatcaccaactttgaactcccaaggacccagactgattat
gagaacagcctgaccatgaagatgttcttgttccagtttgtcaactactactcctcctgc
ttctacatcgcattcttcaagggcaaatttgtcggctatccgggggacccggtgtactgg
ctgggcaaatacagaaacgaagagtgtgacccggggggctgcctccttgaactgactaca
cagctgacgatcatcatggggggaaaggcgatctggaacaacatacaagaagttctgctc
ccgtgggttatgaatctaattggacgatataaaagagtctcgggatcagaaaagataacc
ccacgatgggaacaggattaccatctgcagcccatgggcaggctgggattgttctatgag
taccttgaaatgattattcagtttgggttcgtcaccttatttgtggcctctttcccactg
gctcccctgctggccctggtgaacaatatactggagataagagtggatgcgtggaagctt
acaacacagtttcgacgcatggtgccagagaaagcccaggatatcggcgcgtggcagccc
atcatgcaaggaatagccatcctggccgtggtgaccaacgccatgatcattgccttcacc
tcagacatgatcccccgcctggtgtactattggtccttctccatccctccctatggggac
cacacttactacaccatggacggctacatcaacaacactctctcggtcttcaacatcacc
gacttcaaaaatacagacaaagaaaacccgtacattgggcttgtcaggctctcgttcaca
gtgttaaaccaaaagatttgtctcctaacgtgcctggttgtacttccaggtaccgtgact
tccgaaacccacccgggcacccacaagagtataaacacaacatctactattggcacgtga

DBGET integrated database retrieval system