KEGG   Rattus norvegicus (rat): 315305Help
Entry
315305            CDS       T01003                                 

Gene name
Atf1, Atf-1
Definition
(RefSeq) activating transcription factor 1
  KO
K09053  activating transcription factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04925  Aldosterone synthesis and secretion
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    315305 (Atf1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    315305 (Atf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    315305 (Atf1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    315305 (Atf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf ASD2 DUF4988
Motif
Other DBs
NCBI-GeneID: 315305
NCBI-ProteinID: NP_001094365
RGD: 1307360
Ensembl: ENSRNOG00000061088
UniProt: F7FD47 Q5BK34
Position
7q36
AA seq 268 aa AA seqDB search
MEDSHKSNTSETASQPGSTVPGIISQIVHQVSSLSESEESQDSSDSIGSSQKAHGILARR
PSYRKILKDLSSEDTRGRKGDGENPSISAVTSMSVPTPIYQTSSGQYIAIAPNGALQLAS
PGPDGVQALQTLTMTNSSSAQQGAILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRT
TPSATSLPQTMVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLEN
RVAVLENQNKTLIEELKTLKDLYSHKSV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaagattcccacaagagtaacacttcagagactgcatcacagcctggttcaacagtt
ccgggaatcatttctcagatagtccatcaggtgtcatcgttgtcagaaagtgaggagtct
caggactcatctgacagcataggctcctcacagaaagctcacgggatcctggcgcggcgc
ccatcttacaggaaaattttgaaagacctctcttctgaagacacacggggcagaaaagga
gacggagaaaatcccagcatttctgccgtcacttctatgtctgttccgactcccatctat
cagactagcagcggacagtacattgccattgccccaaacggagccttacagttggccagt
ccaggcccagatggagtacaggccctgcagacattgaccatgacaaattcaagcagtgct
cagcaaggggcgatcctccagtacgcgcagacctctgacggacagcagatactcgtcccg
agcaaccaggtggtggtgcagactgcatcaggagatatgcagacctaccagatccgtacc
acaccatctgccacgtcacttccacagaccatggtgatgacttctcctgttacccttaca
tctcagacaacaaagacagatgacccccaactcaaaagagaaatacggctgatgaaaaac
agagaagctgcccgggagtgccggcggaagaagaaggagtatgtgaagtgcctggagaac
cgagttgctgttctggaaaaccaaaataaaaccctaatagaggagctaaagactctgaag
gacctttattctcataaaagtgtttga

DBGET integrated database retrieval system