KEGG   Rattus norvegicus (rat): 315348
Entry
315348            CDS       T01003                                 

Gene name
Nckap1l, Hem1
Definition
(RefSeq) NCK associated protein 1 like
  KO
K05750  NCK-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    315348 (Nckap1l)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    315348 (Nckap1l)
SSDB
Motif
Pfam: Nckap1
Other DBs
NCBI-GeneID: 315348
NCBI-ProteinID: NP_001101589
RGD: 1312032
Ensembl: ENSRNOG00000036829
UniProt: D3Z8V4
Position
7q36
AA seq 1106 aa
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMESCLKYINK
KFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRLLIGMYNCAHEMLHGHGDPSFPRLGQMV
LEYDHPLKKLTEEFGPHTKAVSGALLSLYFLFVRRNQGAEQWRSAQLLSLISSPPAMINP
ANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLEGSLYITLIREDVLQ
VHKVTEDLFSSLKGYSKRVADIKESKEHAITNSGQFHCQRRQFLRTAVKELETVLNDEPG
LLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSIAELLFLLEEIRALVRRH
IKVIQQYHLQYLARFDVLVLSDIIQNLTVCPEEESVIMSSFVSTLSSLNLKQVDNEEKFD
FSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIIFHSQMLDSVEKMLVETSDLSTF
CFHLRTFEKMFATTLEEPTMLRYTIAFPLICAHFVHCIHEMCPEEYPHLKNHGLHHCNSF
LEELAKQTSNCVLEICAEQRNLNEQLLPKHCATTISKAKNRKSMKQRQAPRKGEPERDKP
GAESHRKNRSLVTNMDKLHLNLTELALAMNHVHSFSVFEHTIFPSEYLSSHLESRLNRAI
VSLAGYNATTQEILRPSELLAGVKAYTSFIQSLAQFLGTDASRIVRNALLQQTQPLDSCG
EQTVTTLYTNWYLESLLRQASSGTIVLSPAMQAFISLPRDGEQNFSAEEFSDISEMRALA
EILGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFTKPELMASLLPQLTGA
ENVLKRMTIIGVILSFRAMAQEGLQEVTLSVFELACAAGVSCDIDPALVAAIANLKADNS
SPEEEYKVACLLLIFLAVSLPLLATDPSSFFSIEKDGYNNNIHCLTKAIIQVSAALFTLY
NKNIETHLKEFLVVASVSLLQLGQETDKLKTRNRESISLLMRLVVEESPFLTLDMLESCF
PYVLLRNAYREVSRAFYLNRLPASSH
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgtctttgacctctgcttaccagcataagttagcagaaaagctcacgatcctgaatgac
cggggtcaaggagttctcattcgcatgtacaacatcaagaagacctgttcagatccaaaa
tccaagccacctttcttactggaaaagtccatggaatcatgtctcaagtacatcaacaag
aagtttcccaacatagatgtccgaaacagcacgcaacatttaggaccagtgcatcgtgaa
aaagctgagataattagatttctcactaactactaccagtcatttgtggatgtcatggaa
tttcgggatcatgtatatgaacttctcaacaccatcgatgcctgccagtgtcattttgat
atcaatctcaacttcgacttcactcggagctacctggacttgattgtgacttacacctca
gtcattttactcctgtcacggatcgaggaccgcaggctactcatcggcatgtacaactgt
gcccatgagatgctccatgggcacggcgaccccagttttcctcgcctgggccagatggta
ctagaatatgaccatcctctgaagaagctgacagaagaatttggacctcacacaaaggct
gtgagtggagccctgctctctctgtacttcctctttgttcggaggaaccagggagctgag
cagtggcgcagtgcccagctcctaagcctcatcagcagccccccggccatgattaaccct
gctaactcagacacaatggcctgcgagtatctgtctgtggaagtgatggagcgatggatc
ataattgggtttcttctttgtcacgggtgcctcaactccaacagccagtgccagaagctg
tggaagctgtgtctggagggttccctgtacatcaccctcatccgggaagatgtgctacag
gtgcacaaggtcaccgaagacctgttcagcagtttgaaagggtacagtaagcgagtagca
gacatcaaggagagcaaggaacatgccattacaaacagtggccagtttcactgtcaacgg
aggcagtttctgcggacagctgtgaaggagttggagactgtgttaaatgatgagccaggc
ctgctgggtcctaaggccctttttgctttcatggccctgtctttcattcgtgatgaggtc
acttggctggttcgccatacagaaaatgtcaccaagactaagacacccgaagactatgct
gactccatcgcagagcttctcttcctgttggaggagatcagggctctggtccgaagacac
atcaaagtgatccagcagtaccatctccagtacctggccagatttgatgtcctcgtgctt
agtgacatcattcagaacctgactgtgtgtcccgaggaggagtctgtcattatgtcctcc
tttgttagtacgctatcctctctgaatcttaagcaagttgataatgaagagaaatttgac
ttttctggattaaggctggactggtttcgcctacaggcatataccagtgtggcaaaggca
cctttgcacctgcacgagaaccctgacctggccaaggtcatgaacctcatcatctttcac
tcccagatgttggactcagtagagaaaatgctggtggagacctctgacctttctactttc
tgctttcacctccgtacctttgagaagatgtttgctacgaccctggaggaaccaaccatg
cttcgctacaccatcgccttccccctgatttgtgctcattttgtccactgcattcatgaa
atgtgcccagaggagtaccctcacctgaagaaccatggtcttcaccactgcaactccttc
ctggaagagctggccaagcagaccagcaactgtgtgcttgagatatgtgctgaacagcgg
aacctgaacgaacagcttctacccaaacactgtgccaccaccatcagcaaagccaagaac
aggaagtccatgaagcagaggcaagctcccaggaaaggagagcctgagagggacaagcca
ggagcagagagccaccgaaagaaccgcagccttgtcacgaacatggacaagctacattta
aacttgactgagttggcactggcaatgaatcatgtgcacagtttctctgtgtttgaacac
accatcttcccatcagagtatctcagcagtcacctggagtccaggctcaacagagccatc
gtgtctttggctggctacaatgccacaacccaggagatccttaggccttccgagcttttg
gcaggagtcaaggcgtacaccagtttcatccagtcattggcacagttcttgggcacagat
gcttccagaattgttcgcaatgccctcctgcagcagacgcagccgctggactcatgtggc
gagcagacagtcaccactctctacacaaactggtacctagaaagtctactcagacaggcg
agcagtggaaccatcgtcctctctccagccatgcaggccttcatcagccttccccgagat
ggggagcagaacttcagtgctgaggagttctcagacatctctgagatgcgagccttggct
gaaattcttggcccctatggcatgaagttcctgagtgaaaacctgatgtggcacgtgact
tctcagattgtggagctgaagaaacttgtggtggaaaacatggatatcctggttcagatc
agatccaacttcaccaagccagaattgatggcatctctgctgccccagctgacaggggct
gaaaatgtgctaaaacgaatgaccatcattggggtgattctcagttttagggccatggcc
caagagggacttcaggaggtcaccctgagtgtctttgagctggcgtgtgctgcaggggtg
agctgtgacattgacccggccttggtggctgccattgccaatctgaaagctgataactca
tcccctgaagaagagtacaaggtggcgtgcctacttttgattttcctcgctgtttccctc
ccactccttgccactgacccttcttccttcttcagcattgagaaagatggctacaacaac
aacatccactgtttgaccaaagccatcatccaggtgtctgctgcccttttcactctgtac
aacaagaacattgaaacgcacctcaaggagtttctggtggtggcctctgtcagcctcttg
cagctgggccaggagactgacaagctcaaaaccagaaatcgtgaatccatttctctgctc
atgcgcttggtggtggaggagtcacccttcttgaccctggacatgctggagtcctgtttc
ccttacgttctactacgcaatgcctatcgggaggtttcccgggccttctacctgaaccgt
ctgccagccagttcccactga

DBGET integrated database retrieval system