KEGG   Rattus norvegicus (rat): 315352Help
Entry
315352            CDS       T01003                                 

Gene name
Nxt2, RGD1560204
Definition
(RefSeq) nuclear transport factor 2-like export factor 2
  KO
K14285  NTF2-related export protein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    315352 (Nxt2)
   03015 mRNA surveillance pathway
    315352 (Nxt2)
   03008 Ribosome biogenesis in eukaryotes
    315352 (Nxt2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    315352 (Nxt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    315352 (Nxt2)
   03009 Ribosome biogenesis [BR:rno03009]
    315352 (Nxt2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     315352 (Nxt2)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    315352 (Nxt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTF2
Motif
Other DBs
NCBI-GeneID: 315352
NCBI-ProteinID: NP_001101590
RGD: 1560204
Ensembl: ENSRNOG00000019168
UniProt: B2GV77
Position
Xq33
AA seq 142 aa AA seqDB search
MAMAVDFKMYVDQACRAAEEFVNIYYETMDKRRHALVRLYLDKATLIWNGNVVTGLEALA
NFFEMLPSSEFQINMLDCQPVHEQATQYQTTVLVVTSGVVKFDGNKQHFFNQNFLLTAQS
TPNSTVWKIASDCFRFQDWASI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggccatggccgtggattttaaaatgtatgtggatcaagcatgtagagctgctgaggaa
tttgtcaatatttactatgagacaatggacaaaagacggcatgcacttgtcaggctgtat
ttggacaaggccactctaatctggaatggaaatgttgttacagggctggaagcccttgct
aatttttttgagatgttgccttccagtgaattccagatcaatatgttagattgccaacca
gttcatgagcaagctacccagtaccagactacagtgctcgtcgtgaccagtggagtggtg
aagtttgatggaaacaaacaacacttctttaaccagaacttcctgttgactgcgcagagc
actcctaacagcacggtgtggaagattgcaagtgattgcttccgttttcaagattgggct
agtatttaa

DBGET integrated database retrieval system