KEGG   Rattus norvegicus (rat): 315427
Entry
315427            CDS       T01003                                 

Gene name
Sesn3
Definition
(RefSeq) sestrin 3
  KO
K10141  sestrin 1/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
rno04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    315427 (Sesn3)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    315427 (Sesn3)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 315427
NCBI-ProteinID: NP_001101595
RGD: 1309470
Ensembl: ENSRNOG00000008173
UniProt: D4A469
Position
8q12
AA seq 492 aa
MNRGGSSASASANYLLCTNCRKVLRKDKRIRMSQPLTRGPSAFIPEKEVVQANTADERTN
FLVEEYSTSGRLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPDRHYIAIMAAARHQ
CSYLINMHVDEFLKTGGIAEWLNGLEYVPQRLRNLNEINKLLAHRPWLITKEHIQKLVKT
GENNWSLPELVHAVVLLAHYHALASFVYGSGINPERDPGIANGFRLISVSSFCVCDLAND
NSIGNASLAGGNFGIVDSLGELEALMERMKRLQEDREDEETTPEEMSTRFEKEKKESLFV
VPGETFHSFPHSDFEDDMIVTADVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHG
FSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTTLRRALFNYVHCMFGIRYDDY
DYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFTHSEKVHVNLLLMEARMQAEL
LYALRAITRHLT
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaaccgcggtggcagcagcgcgtcggcctcggccaactacctgctctgcaccaactgc
cggaaagtgctgcggaaggacaaaagaatcagaatgtctcaacccctgacaagaggacca
agtgcctttattccagagaaggaagttgtccaagcaaacacggcagatgaacgaacaaac
tttcttgtggaagagtactctacatccggtcgcctggacaacatcacacaggtgatgagc
ttgcacacgcagtacctggaatctttcttacggagccagttctacatgctgcgcatggat
ggcccccttcccctcccggacaggcactacatcgccatcatggctgcagccagacaccag
tgttcctacctaataaacatgcatgtggatgaatttttaaagaccggagggattgctgag
tggctcaatggcttggaatatgtaccacaaagactgagaaatcttaatgaaattaacaag
ctgctggcacaccggccctggctgatcacgaaagagcacattcagaaacttgtcaaaact
ggagaaaataattggtccttgcctgagctagtgcacgctgtggtcctcttggctcactat
cacgctctggccagctttgtttatggtagtggcatcaatccagaaagagaccccggaatc
gccaatgggttcagactgatctcagtgagcagcttctgtgtgtgcgacctggccaatgac
aacagcattggaaatgcctccctggcaggcggcaactttgggattgtggactctctaggt
gagctagaagccttaatggagaggatgaaaaggctccaggaagacagggaagatgaagag
actactccggaagaaatgagcacacgttttgagaaggaaaagaaagaaagtctcttcgtg
gtccctggagagactttccactcgtttcctcactcagattttgaagatgacatgattgta
acagctgatgtctctcgatacatcgaagacccaggctttgggtatgaagacttcgccagg
cgaggagaagaacatttgccaacattccgagcccaggactacacctgggaaaatcatggg
ttctcgctggtgaacaggctttactctgacattgggcatctcctggatgagaagtttcga
atggtctacaatctcacctacaacacaatggccacccatgaggatgttgacactaccacg
ctgcgcagagccctgtttaactatgttcactgtatgtttggaatcaggtatgatgactat
gactatggagaagttaaccagttactcgagcggagcctgaaggtttacatcaagacagtg
acctgctacccggagcgaaccacgaagcgcatgtatgacagctactggcggcagttcacc
cactcagagaaggtccacgtgaacctgcttctgatggaggcgcggatgcaggccgagctg
ctttacgccctgcgggccataactcggcatctgacctga

DBGET integrated database retrieval system