KEGG   Rattus norvegicus (rat): 315497Help
Entry
315497            CDS       T01003                                 

Gene name
Tbx20
Definition
(RefSeq) T-box 20
  KO
K10185  T-box protein 20
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    315497 (Tbx20)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   T-box
    315497 (Tbx20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 315497
NCBI-ProteinID: NP_001101602
RGD: 1309396
Ensembl: ENSRNOG00000016181
UniProt: D3ZUF4
Position
8q13
AA seq 298 aa AA seqDB search
MEFTASPKPQLSSRANAFSIAALMSSGGPKEKEAAENTIKPLEQFVEKSSCAQPLGELTS
LDAHAEFGGGGGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEM
IITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLP
ARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHT
ASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagttcaccgcgtcgcccaagcctcagctctcctctcgagccaatgccttctccatc
gccgcgctaatgtccagcggcggccccaaggagaaggaggcagcagagaacaccatcaaa
cccctggaacaatttgtggagaaatcgtcctgtgcccagccgctgggtgagctaactagc
ctggatgctcacgcggagtttggcggcggcgggggcagcagcccttcctcatcctctctg
tgcacagagccactgatccccaccacccccatcatccccagcgaagagatggctaaaatc
gcctgcagcctggaaacgaaggagctctgggacaaattccatgaactgggcacggagatg
attatcaccaagtctggcaggaggatgttccccaccatccgcgtgtcattttctggagtg
gatcctgaggccaagtacatagtcctgatggacatcgtcccggtggacaacaagagatat
cgctatgcctatcaccggtcctcctggctggtggctggcaaggctgatcctcccctgcca
gccaggctctacgtgcatccagactccccctttactggcgagcagctcctcaaacagatg
gtgtcctttgaaaaggtgaagctcaccaacaatgaactggaccaacatggccatataatt
ttgaattcaatgcataagtaccagccgagggtgcacatcataaagaagaaagaccacacg
gcctccttgctcaatctgaagtcggaagaattcaggacgttcatctttccagagacagtc
ttcacagcagtcacagcctaccagaaccaactgataaccaagctgaaaatagacagcaat
ccgtttgccaaaggattccgggactcctccaggctcactgacatcgagagggaatga

DBGET integrated database retrieval system