KEGG   Rattus norvegicus (rat): 315508Help
Entry
315508            CDS       T01003                                 

Gene name
Ncapd3
Definition
(RefSeq) non-SMC condensin II complex, subunit D3
  KO
K11491  condensin-2 complex subunit D3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    315508 (Ncapd3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Chromosome condensation proteins
   Condensin II
    315508 (Ncapd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cnd1 HEAT HEAT_2 CLASP_N Cnd3 Adaptin_N DUF3013 DUF1043
Motif
Other DBs
NCBI-GeneID: 315508
NCBI-ProteinID: NP_001029172
RGD: 1562176
Ensembl: ENSRNOG00000008932
UniProt: Q3T1H0
Position
8q13
AA seq 1494 aa AA seqDB search
MALKDLGRDLQPWCPLDLSLEWVNTVWDLDFTETEPLDPSVVAEILETGRDAFTKLYGSL
FPFATDESGSLESVWSFFTENSISSNTLVALFCHFVQEAHKKSASVQYREYGLRAAGLYF
LLLEIPGSVVNQVFHPVMFDKCIQILKKSWPQESNLTQKRKKEHSKSSKANYRRSRKRGK
PPRKEDYQVDELSREEEEEEEEEIYFSVRDLSQIRDAIFNLLKNFLRLLPKFSLKEKPQS
IQTCIEVFVALTSFEPIPHKFLISQARNLSEVKHISELAYYGLYLLCSPVHGEGNKVIGS
IFHQMLNVILMLEVGEGSRCAPLAITSHVINCRNQAVQFVSSLVDELQESVFPILGTLLQ
HICAKVVDKAEYRTYAAQSLVQLLSKLPSKEYATFIAWLYKYSRSSKIPHRVFTLDVALA
LLELPERLLDDTVLLEHQKFLKHKFFVQEIIFDRCLDKAPTVRSKALSSFAQCLELSTSN
TSENTLEIFINSTVTGIHSHFGTSLRPSTVLTSQSCRSVQSSTHDSDEQTPPGERRFMTM
LRKRTKDEKINVRKSALQVLMSILKHCDILSMEEDLLILQDHCRDPAISVRKQALQSLTE
LVMAKPTCVPVQKAWLMGVIPVVMDYESTVQEKALECLDQLLLQNIKHHRKFHSEDRSQV
LAWALLALLTVESQDLSRYLNKAFHIWSKKDKFSSTFINSVISHTDTERSAPAWMLLSKI
TCSSPKLDYTKIMESWEKLSREQSPNSNTLGYMLCVIGHIAKHLPKSTQDKITGVIKAKL
NGFQWSLELISLSVDTLQGLCRASAKTLREEQELLKRVCGDVLSTCEQHLSNILLKEDGT
GNMDEDLVVKCIFTLGDIAQLCPALVEKRVFLLIQSILASSAHADHLPSSQGTTDLASQL
PFQARSSALPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNNVIIVMC
DLCIRYTVMVDNYIPNISICLKDSDPFIRKQTLILLTNLLQEEYVKWKGSLFFRFVSTLV
DSHPDIASLGEFCLAHLLLKRNPTMFFQHFIECIFHFNSYEKHGQYNKFSQSERGKPLFL
LKGKTNKEKRMRIYKFLLEHFTDEQRFNVTSKICLNILACFTDGVLPVDMEASELLSDTF
DILSSKEIKLLAMRAQASKELLEEDDVALANVVMQEAQMKIISQVQKRNFIENIIPIIIS
LKTVLEKNKIPALRELMNYLREVMQDYRDEIKDFFAVDRQLASELEYDMKKYTEQLAQEQ
ALTEHANATNVPADGDRVPSQQVAPDLQAVPGAAAAAGAGQADANMPLPLAQSQPSAPGS
SFTPTLPPICEKGPLKIMSSTRPMSLSTIAILNSVKKAVASKSRTRSLGALSFNMENGSP
ENPSSRASSLSLEQESERAVKRVTKRAISTPEKSISNVTFGAGVSYIGTPATSFFTKEKP
EEAQEEGNDILCLSLLDKRPPQSPQWNVKSPARSQDNPRSGRRSLRKAPLKTAN
NT seq 4485 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaggatctaggaagagacctgcagccttggtgtccgctggatctcagcctt
gaatgggtgaacacagtgtgggacctggacttcacggagaccgaacctttggatcccagc
gtggtagcagagatcctagagactggaagagatgcgttcacaaagctctatgggagcctc
ttcccctttgcaaccgacgaaagtggctctttagagagcgtctggtccttcttcactgag
aacagcatttccagcaacactctggtggcgttgttctgtcactttgtccaggaagcccat
aaaaaaagtgccagtgtgcaatatcgagaatatggccttcgtgctgcggggctctatttc
ctgctgctagaaataccaggcagcgtagtcaatcaagtattccacccagtgatgttcgac
aagtgtattcagatcctgaagaagagctggcctcaagaatccaacttgactcagaagaga
aaaaaggaacactccaagagttctaaggctaattacaggaggagcagaaaaagaggaaaa
ccacctaggaaagaggattatcaggtggatgaactttcaagagaggaagaggaggaggag
gaagaggagatttatttttctgtccgggacctttctcaaatacgagatgccatatttaat
cttctaaagaattttttaaggcttctgcccaagttttctcttaaagaaaagccgcagtct
attcaaacatgtatagaggtgtttgttgcattaactagttttgaaccaattcctcataaa
tttcttatttcacaagccaggaacctcagtgaagtaaaacacatttcagagctggcctac
tatggattgtacttgctgtgctccccagttcatggagaaggaaataaggttatcggttct
atttttcatcaaatgctcaatgtgatactgatgttagaggtaggagaagggtcccgctgt
gctcctcttgccataacctcacacgtcatcaattgtagaaaccaagcagtccagtttgtc
agctcacttgtggatgaactacaagaaagtgtgttccccatccttggtactttactgcag
cacatctgtgccaaggtggtggataaagcagaatatcggacctacgcagcacagtccctg
gtccagctgcttagcaaacttccctccaaggaatatgctacattcattgcctggctttac
aaatattcacgaagttccaagatcccacaccgggtcttcactcttgatgttgctttagct
ctgttagagctgcccgaaagactgctggatgacactgtgctactggagcatcagaagttt
ctaaagcataaattctttgtgcaagaaattatatttgatcgttgcttagataaggcacct
actgtccgcagcaaggcgctgtccagctttgcacagtgtttggagttgtctactagcaac
acatctgagaacacactggaaatcttcattaacagtactgtgacaggaatacacagtcac
tttggcacctcactgagaccctcgacagtgttaaccagccaaagttgccgctcagtacaa
agcagcacccatgacagtgatgaacagactccgcctggagagagacgcttcatgacaatg
ctgagaaaaagaaccaaagatgagaagatcaacgttaggaagtctgcactccaggtgtta
atgagtattttgaaacactgtgacatcttgagcatggaggaggacctgttgatcctgcag
gaccactgtcgagaccctgccatatctgtgcggaagcaagccctacagtctcttacagaa
cttgtcatggccaagcctacttgtgtcccagtgcagaaggcctggctgatgggtgtcatc
cctgtggtgatggactatgagagcacagtgcaagagaaggccttggagtgcctggaccag
ctcctgctgcagaacattaagcaccataggaagtttcacagcgaggacaggagtcaggtg
ctcgcctgggccctacttgctctcctcaccgtagaaagccaagatctgagccgctattta
aataaggcttttcatatctggtccaagaaagataaattctcatccacttttataaacagt
gtgatatcccacactgacacagaacgttctgcgccagcctggatgctgctctccaagatc
acttgctcgtcacccaagctggactataccaaaataatggagtcgtgggagaaactcagc
agagaacaatctcccaactcaaacaccttaggctacatgctgtgtgtcattgggcatatt
gcaaagcatcttccaaagagcacacaggacaagataactggtgtgatcaaggccaagctg
aatggatttcagtggtctctagagctgatcagtttgtccgttgacacattacaagggctt
tgcagagcatctgcaaagacactgcgggaagagcaggaactgctgaagcgggtgtgtggg
gatgtcctctccacctgtgagcaacacctctctaacatccttctgaaggaagacgggaca
gggaacatggatgaagacctggtggtgaaatgcatttttaccctaggagatatagcccag
ttatgtccagccctagtagagaagcgagtcttccttctaatccagtctattctggcttct
tctgctcatgcggatcacttgccatcatctcaagggaccacagacctcgccagtcagctg
cctttccaggccaggagctctgccctgccgtctgtgattagagcacatgccatcatcact
ctgggtaaactctgcttacagcatgaagaccttgcaaagaaaagcatcccagcccttgtg
cgagaacttgaagtctgtgaggatgtggctgtccgcaacaatgtcatcattgtgatgtgt
gatctttgtatccggtacactgtcatggtggacaattatattcccaatatttccatttgc
ctgaaggattcagacccgttcatccgaaagcagacactgatcttgcttaccaacctctta
caggaggaatatgtgaagtggaagggctctctgttcttccgatttgtcagcactctggta
gactcacacccagacattgccagccttggggagttctgcctggctcacttgttgctgaag
aggaaccctaccatgtttttccagcacttcattgagtgcatattccacttcaacagctat
gagaagcatgggcagtataacaagttttcccagtcggagagggggaagccactgtttttg
ctaaagggaaagacaaacaaggagaagcgaatgagaatctacaagtttcttcttgagcac
ttcacagatgagcagcgattcaatgtcacttccaagatctgtcttaacattttggcgtgc
ttcacggatggcgtcctgcccgtggacatggaagccagcgagctgctctccgataccttt
gacatcctcagctctaaggagatcaaactattggcaatgagagcgcaggcatccaaggag
ctcctggaggaagatgacgtggctctggcgaatgtggtcatgcaggaggcccagatgaag
attatctcgcaggttcaaaagaggaatttcatagagaatattattccaatcatcatctcc
ctgaagactgtgctggagaaaaataagatccctgctttaagggaactcatgaactacctc
agggaagtaatgcaggattaccgcgatgagatcaaagacttctttgcagtggacagacag
ctggcgtctgagcttgagtatgacatgaagaagtacactgaacaactggcccaggagcaa
gctctgacggagcatgctaatgccaccaacgtgcctgcagacggggacagggtcccctcc
cagcaggttgctccagacttacaagctgtacctggcgctgctgccgccgctggtgctggc
caggccgatgctaacatgcctctgcctctggcccagagccagccttcagcacctgggtcc
agcttcacaccaactttgcctcctatatgcgaaaagggacctctgaagataatgtccagt
accaggcccatgtctctgagtaccatcgcaatcctgaattcagtcaagaaagctgttgcg
tctaagagcaggacacgcagtttaggagccctgtctttcaacatggagaacggaagccca
gaaaatccctccagccgtgcgtcttccttgagcttggagcaggagtctgagagagccgtc
aagcgtgtgactaaaagggcgatcagcaccccagagaagtccatcagcaatgtcacattt
ggagcaggggtcagttacatagggacaccagcaacttcgttttttaccaaagagaaacct
gaagaagcccaggaagaaggaaatgacattttatgtttgtcattgcttgataaaaggcct
ccgcagtctccacagtggaatgtgaagtctccagccaggagccaagacaacccccggtcc
ggcagaaggtcccttcgcaaggccccgctgaagacagccaactga

DBGET integrated database retrieval system