KEGG   Rattus norvegicus (rat): 315548
Entry
315548            CDS       T01003                                 

Gene name
Srpra
Definition
(RefSeq) signal recognition particle receptor subunit alpha
  KO
K13431  signal recognition particle receptor subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    315548 (Srpra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    315548 (Srpra)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   315548 (Srpra)
SSDB
Motif
Pfam: SRP-alpha_N SRP54 SRP54_N MeaB CbiA AAA_30 AAA_16 DUF5693 PfkB Fer4_NifH ArsA_ATPase DinB
Other DBs
NCBI-GeneID: 315548
NCBI-ProteinID: NP_001029322
RGD: 1311504
Ensembl: ENSRNOG00000010543
UniProt: Q3KRC3
Position
8
AA seq 636 aa
MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLDN
QFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL
LREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKTKEKAKNNKKKGSKKEGSDGP
LATSKTAPAEKSGLPVGPENGELSKEELIRRKREEFIQKHGKGLDKSSKSTKSDIPKEKG
KKAPRVWELGGCANKEVLDYSTPTTNGTPEAALSEDINLIRGTGPGGQLQDLDCSSSDDE
GATQNTKPSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQL
CESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYVVT
FCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLTALHPPEKHG
GRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVN
TPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAAIS
MTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgcttgacttcttcaccatcttctcgaagggcgggcttgtgctctggtgtttccagggc
gtgagcgactcgtgcaccgggcccgtgaacgcgttgattcgttctgtactgctgcaggaa
cggggaggtaacaactctttcactcatgaggctctcacactcaagtataaactggacaac
cagtttgaactggtgtttgtggttggctttcagaagatcctcacactgacctatgtagac
aaattgatagatgatgtgcaccggctgttccgggataagtaccgcacagagatccaacaa
cagagtgctttaagtttattgaatggcacttttgatttccaaaatgacttcctgcggctc
cttcgtgaagcagaggagagcagtaagatccgtgctcccactaccatgaagaaatttgaa
gattctgaaaaagctaagaaacctgtgagatccatgattgaaacacggggggaaaagacc
aaggaaaaagcaaaaaacaacaaaaaaaaggggtccaaaaaggaaggttctgatggccct
ttggctaccagcaaaacagcccctgcagaaaagtcaggtctcccagtgggacctgagaat
ggggaactttccaaagaggagctgatacgtaggaagagagaggagttcattcagaagcat
gggaagggcctggacaaatccagtaaatctacaaagtcagatattccaaaggagaaaggc
aaaaaagcaccccgggtgtgggaactaggtggctgtgctaacaaggaagtcttggattac
agtactcccaccaccaatggaactccagaggcagccctttctgaagatatcaacttgatt
cgaggaactgggcctgggggacagcttcaagatctggattgcagcagttcagatgatgaa
ggggctactcaaaacaccaaacctagtgctaccaagggaactctgggtggcatgtttggg
atgctgaagggtctggtgggttccaagagcttgagtcgagaagacatggaatctgtgcta
gacaagatgcgtgatcatctcattgctaagaatgtggctgctgacattgctgtccagctc
tgtgaatctgttgccaacaagttagaaggcaaagtgatggggacatttagcactgtgact
tcaacagtgaagcaagctctacaagagtctctggtgcagatcctgcagccacagcgtcga
gtagacatgctccgggatatcatggatgcccaacgtcgccagcgcccttacgtagttacc
ttctgtggtgttaatggagtggggaagtctactaatcttgccaagatctccttctggctt
ttagagaatggctttagcgtcctcattgctgcctgcgatacatttcgtgctggggctgtt
gagcagctccgcacacacacccggcgcctgactgcccttcatcccccggagaagcatggt
ggccgaacgatggtgcagttgtttgaaaaaggctatggcaaggacgctgctggcattgcc
atggaagccattgcctttgcacgtaaccaaggctttgacgtggtgctggtggacactgct
ggccgcatgcaagacaatgctcctctgatgactgccctggccaaactcattactgtcaat
acacctgacttggtgctgtttgtgggggaggccttagtaggcaatgaagctgtggatcaa
ctggtcaaattcaacagagccttagctgaccattctatggctcagacacctcggctcatt
gatggcattgttctaaccaaatttgacaccattgatgacaaggtgggagctgctatttct
atgacatacatcacaagcaaacccatcgtctttgtgggtactggccagacctactgtgac
ctacgcagtctcaatgccaaggctgtggtggctgccctcatgaaggcttaa

DBGET integrated database retrieval system