KEGG   Rattus norvegicus (rat): 315549Help
Entry
315549            CDS       T01003                                 

Gene name
Fam118b, Ppp4r1l, RGD1307173
Definition
(RefSeq) family with sequence similarity 118, member B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2_2 DUF5443
Motif
Other DBs
NCBI-GeneID: 315549
NCBI-ProteinID: NP_001020454
RGD: 1307173
Ensembl: ENSRNOG00000011543
UniProt: Q4QQT2
Position
8q21
AA seq 350 aa AA seqDB search
MASTGSQASDIDKIFGFFNDGEPPTKKPRKLLPSLKTKKPRELVLVIGTGISAAVAPQVP
ALKSWKGLIQALLDAAIDFDLLEDEESKKFQKCLHEDKNLVHVAHDLIQKLSPRTSNVRS
TFFKDCLYEVFDDLESKMEDSGKQLLQSVLHLMENGALVLTTNFDNLLELYAADQGKQLE
SLDLTDEKKVLEWAQEKRKLSVLHIHGVYTNPSGIVLHPAGYQNVLRNTEVMREIQKLYE
NKSFLFLGCGWTVDDTTFQALFLEAVKHKSDLEHFMLVRRGDVDEFKKLRENMLDKGIKV
ISYGNDYADLPEYFKRLTCEISTRGRSGMAREGQLNGSSAAHGEIRGCST
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcttctacagggagccaggcctctgatatagacaagatttttggattcttcaatgat
ggcgagcctcccaccaaaaagcccaggaagctgcttccaagtctgaaaaccaaaaagcct
cgagaacttgtgctggtgattgggacaggcattagtgctgcagtggcaccgcaggtccca
gccctgaaatcctggaaggggttaattcaggccttactggatgctgccattgactttgat
cttctagaagacgaggaaagcaaaaaatttcagaaatgtctccatgaagacaagaacctc
gtccatgttgcccatgacctcattcagaaactttcccctcgtaccagtaatgttcgatcc
acatttttcaaagactgtttatatgaagtatttgatgacctggaatcaaagatggaagat
tctggaaaacagctccttcagtctgttctccacctgatggaaaatggagccctagtatta
actacaaattttgataatctcctagaactctatgcagctgaccagggaaaacaacttgaa
tcccttgaccttactgatgagaaaaaggtcctggagtgggctcaggagaagcggaagcta
agtgtgctacacatccatggggtctataccaatcctagtggcatcgtcctccacccagct
ggatatcagaatgtgctcaggaacactgaagttatgagagagattcagaaactctatgaa
aacaagtcatttcttttcttgggttgtggctggacggtggacgacaccactttccaggcc
ctgttcctagaagctgtcaagcataaatctgacttagaacatttcatgttggttcgaaga
ggagatgtagatgaattcaagaagcttcgagaaaacatgctggacaaggggattaaggtc
atctcctatggaaatgactatgctgatcttccagaatacttcaagcgactgacatgtgag
atctccacaagaggcagatcagggatggcaagagaaggccagctaaatggttcatctgca
gcacatggtgaaataagaggctgtagtacttga

DBGET integrated database retrieval system